Protein detail
TRPM1
Transient receptor potential cation channel subfamily M member 1 (Long transient receptor potential channel 1) (LTrpC1) (Melastatin-1)
Entry name TRPM1 | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 1 | Transmembrane count 6 | Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransportersVoltage-gated ion channels |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Transient receptor potential cation channel subfamily M member 1 (Long transient receptor potential channel 1) (LTrpC1) (Melastatin-1)
Protein Class (7)
Disease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransportersVoltage-gated ion channels
Protein Function (7)
- Voltage-gated ion channels:Transient Receptor Potential Channels
- Human disease related genes:Other congenital disorders:Chromosomal abnormalities
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Transporter channels and pores
- Disease related genes
- Human disease related genes:Nervous system diseases:Eye disease
Transmembrane
831..851; Helical; 898..918; Helical; 929..949; Helical; 962..982; Helical; 1055..1075; Helical; 1106..1126; Helical
Transmembrane Count
6
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
CSNB1CLTRPC1MLSN1
Gene Description
Transient receptor potential cation channel subfamily M member 1
Chromosome
15
Position
31001065-31161160
Supporting publications (n)
1
EVMP confidence score
0.28
Fluorescence & Localization
Cell SpecificDecidual stromal cellsSingle-Nuclei Brain Specificfibroblast
Function & Pathway
Protein Function (7)
- Voltage-gated ion channels:Transient Receptor Potential Channels
- Human disease related genes:Other congenital disorders:Chromosomal abnormalities
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Transporter channels and pores
- Disease related genes
- Human disease related genes:Nervous system diseases:Eye disease
Cellular Component (4)
Molecular Function (3)
Biological Process (3)
Reactome (7)
- R-hsa-983712 ion channel transport
- R-hsa-9856651 mitf m dependent gene expression
- R-hsa-9730414 mitf m regulated melanocyte development
- R-hsa-9824594 regulation of mitf m dependent genes involved in apoptosis
- R-hsa-2672351 stimuli sensing channels
- R-hsa-382551 transport of small molecules
- R-hsa-3295583 trp channels
Mediation Categories (2)
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence21
Ligand-Receptor Signaling (20)
20 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_topology | |||||
| transmembrane | transmembrane | UniProt_keyword | |||||
| transmembrane | transmembrane | LOCATE | |||||
| transmembrane | transmembrane | Ramilowski_location | |||||
| transmembrane | transmembrane | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath | |||||
| receptor | receptor | scConnect | Yes | ||||
| receptor | receptor | CellCellInteractions | Yes | ||||
| transmembrane | transmembrane_predicted | Phobius |
Page 2 of 2Previous
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometryR Sequencing | 1 | 21630462 |
Sequence, Structure & Domains
Sequences
Length
1,603
Mass
182,178
Sequence
MKDSNRCCCGQFTNQHIPPLPSATPSKNEEESKQVETQPEKWSVAKHTQSYPTDSYGVLEFQGGGYSNKAMYIRVSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQNFEMQPKLKQVFGKGLIKAAMTTGAWIFTGGVSTGVISHVGDALKDHSSKSRGRVCAIGIAPWGIVENKEDLVGKDVTRVYQTMSNPLSKLSVLNNSHTHFILADNGTLGKYGAEVKLRRLLEKHISLQKINTRLGQGVPLVGLVVEGGPNVVSIVLEYLQEEPPIPVVICDGSGRASDILSFAHKYCEEGGIINESLREQLLVTIQKTFNYNKAQSHQLFAIIMECMKKKELVTVFRMGSEGQQDIEMAILTALLKGTNVSAPDQLSLALAWNRVDIARSQIFVFGPHWPPLGSLAPPTDSKATEKEKKPPMATTKGGRGKGKGKKKGKVKEEVEEETDPRKIELLNWVNALEQAMLDALVLDRVDFVKLLIENGVNMQHFLTIPRLEELYNTRLGPPNTLHLLVRDVKKSNLPPDYHISLIDIGLVLEYLMGGAYRCNYTRKNFRTLYNNLFGPKRPKALKLLGMEDDEPPAKGKKKKKKKKEEEIDIDVDDPAVSRFQYPFHELMVWAVLMKRQKMAVFLWQRGEESMAKALVACKLYKAMAHESSESDLVDDISQDLDNNSKDFGQLALELLDQSYKHDEQIAMKLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILLPPTILFLEFRTYDDFSYQTSKENEDGKEKEEENTDANADAGSRKGDEENEHKKQRSIPIGTKICEFYNAPIVKFWFYTISYLGYLLLFNYVILVRMDGWPSLQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQEYWNITDLVAISTFMIGAILRLQNQPYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQIDLYAMEINPPCGENLYDEEGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHDRPVLPPPMIILSHIYIIIMRLSGRCRKKREGDQEERDRGLKLFLSDEELKRLHEFEEQCVQEHFREKEDEQQSSSDERIRVTSERVENMSMRLEEINERETFMKTSLQTVDLRLAQLEELSNRMVNALENLAGIDRSDLIQARSRASSECEATYLLRQSSINSADGYSLYRYHFNGEELLFEDTSLSTSPGTGVRKKTCSFRIKEEKDVKTHLVPECQNSLHLSLGTSTSATPDGSHLAVDDLKNAEESKLGPDIGISKEDDERQTDSKKEETISPSLNKTDVIHGQDKSDVQNTQLTVETTNIEGTISYPLEETKITRYFPDETINACKTMKSRSFVYSRGRKLVGGVNQDVEYSSITDQQLTTEWQCQVQKITRSHSTDIPYIVSEAAVQAEHKEQFADMQDEHHVAEAIPRIPRLSLTITDRNGMENLLSVKPDQTLGFPSLRSKSLHGHPRNVKSIQGKLDRSGHASSVSSLVIVSGMTAEEKKVKKEKASTETEC
Alternative Products
Event=Alternative splicing; Named isoforms=7; Name=1; IsoId=Q7Z4N2-1; Sequence=Displayed; Name=2; IsoId=Q7Z4N2-2; Sequence=VSP_052748; Name=3; IsoId=Q7Z4N2-3; Sequence=VSP_052749; Name=4; IsoId=Q7Z4N2-4; Sequence=VSP_052750; Name=5; IsoId=Q7Z4N2-5; Sequence=VSP_046786; Name=6; IsoId=Q7Z4N2-6; Sequence=VSP_046787; Name=7; IsoId=Q7Z4N2-7; Sequence=VSP_046788, VSP_046789
Alternative Sequence
1..70; Missing (in isoform 2); 1; M -> MSSFKRGSLKSSTSGSQKGQKSWIEKTFCKRECIFVIPSM (in isoform 5); 1; M -> MGQKSWIEKTFCKRECIFVIPSM (in isoform 6); 72..136; YIRVSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQNFEMQPKLKQVFGKGLIKAAMTTGAWIF -> VRKAFRHGATRITAFIGGQSPSPKLQIPGLLHGCGSIFLDISLKNQEIYLCTWLLAMRLGNWTPL (in isoform 7); 137..1603; Missing (in isoform 7); 295..300; Missing (in isoform 3); 301..1603; Missing (in isoform 4)
Domain & Motif Annotations
Compositional Bias
427..438; Basic residues; 778..787; Basic and acidic residues; 798..808; Basic and acidic residues; 1352..1376; Basic and acidic residues
Coiled Coil
1182..1240
Region
16..47; Disordered; 403..445; Disordered; 573..596; Disordered; 777..810; Disordered; 1352..1380; Disordered
Protein Families (3)
- Transient receptor (TC 1.A.4) family
- LTrpC subfamily
- TRPM1 sub-subfamily
Sequence Similarities
Belongs to the transient receptor (TC 1.A.4) family. LTrpC subfamily. TRPM1 sub-subfamily.
Clinical Relevance
Disease Involvement (2)
Congenital stationary night blindnessDisease variant
Related Diseases
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 38039414 | Plasma levels of BCMA-positive extracellular vesicles correlate to response and side effects in myeloma patients treated with belantamab-mafodotin. | Plasma levels of BCMA-positive extracellular vesicles correlate to response and side effects in myeloma patients treated with belantamab-mafodotin. |