Protein detail

BTLA

B- and T-lymphocyte attenuator (B- and T-lymphocyte-associated protein) (CD antigen CD272)

Entry name BTLA	UniProt ID Q7Z6A9	EVMP confidence score 0.25
Supporting publications (n) 1	Transmembrane count 1	Protein classification CD markersPredicted membrane proteinsPredicted secreted proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

B- and T-lymphocyte attenuator (B- and T-lymphocyte-associated protein) (CD antigen CD272)

Protein Class (3)

CD markersPredicted membrane proteinsPredicted secreted proteins

Protein Function (2)

Predicted secreted proteins
CD markers

Transmembrane

158..178; Helical

Transmembrane Count

Ensembl

ENSG00000186265

Entrez Gene Symbol

BTLA

Gene Synonym (2)

BTLA1CD272

Gene Description

B and T lymphocyte associated

Chromosome

Position

112463966-112499472

Supporting publications (n)

EVMP confidence score

0.25

Fluorescence & Localization2

Tissue SpecificretinaCell SpecificBasal keratinocytes

Function & Pathway6

Protein Function (2)

Predicted secreted proteins
CD markers

Cellular Component

GO:0005886 plasma membrane

Molecular Function (2)

Biological Process (3)

Reactome (3)

Mediation Categories (2)

Clinical-translation mediationImmune mediation

Relations & Evidence42

Enzyme-Mediated Modification (4)

4 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database
BTLA	LCK	P06239	Y	257	phosphorylation	PhosphoSite
BTLA	LCK	P06239	Y	226	phosphorylation	PhosphoSite
BTLA	LCK	P06239	Y	282	phosphorylation	PhosphoSite
BTLA	LCK	P06239	Y	243	phosphorylation	PhosphoSite

Ligand-Receptor Signaling (35)

35 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
plasma_membrane	plasma_membrane	Cellinker	No	No	No	Yes	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	Membranome	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	CSPA	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	No	No	No	Yes	No
cell_surface	cell_surface	Surfaceome	No	No	No	Yes	No
cell_surface	cell_surface	connectomeDB2020	No	No	No	Yes	No
cell_surface	cell_surface	OmniPath	No	No	No	Yes	No
receptor	receptor	connectomeDB2020	No	Yes	No	Yes	No
receptor	receptor	iTALK	No	Yes	No	Yes	No

Page 3 of 4Previous Next

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
LCK	P06239	BTLA	Q7Z6A9	Yes	No	No	PhosphoSite_norefPhosphoSitePhosphoSite_ProtMapperProtMapper	PhosphoSite:32437509

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	BTLA	Q7Z6A9	4	PDB	PDB:6nyp

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	39408670

Sequence, Structure & Domains9

Sequences

Length

289

Mass

32,834

Sequence

MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q7Z6A9-1; Sequence=Displayed; Name=2; IsoId=Q7Z6A9-2; Sequence=VSP_040305

Alternative Sequence

135..182; Missing (in isoform 2)

3D Structural Models

Helix

107..109

Beta Strand

44..49; 54..61; 63..65; 70..75; 78..81; 87..92; 95..102; 111..119; 122..125; 129..134

3D Structure

X-ray crystallography (5)

Domain & Motif Annotations

Domain (FT)

31..132; Ig-like V-type

Clinical Relevance3

Related Diseases (3)

Lupus erythematosus Sjogren syndrome Solid tumour/cancer

Biomarker

Phase 2; Phase 1

Antibody (3)

HPA047211 HPA062029 CAB080456

Supporting Publications1

PMID	Title	Abstract
32384937	Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles.	No abstract available