Protein detail

DHDDS

Dehydrodolichyl diphosphate synthase complex subunit DHDDS (EC 2.5.1.87) (Cis-isoprenyltransferase) (CIT) (Cis-IPTase) (Cis-prenyltransferase subunit hCIT) (Epididymis tissue protein Li 189m)

Entry name DHDDS	UniProt ID Q86SQ9	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count	Protein classification Disease related genesEnzymesEssential proteinsHuman disease related genesMetabolic proteinsPotential drug targetsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Dehydrodolichyl diphosphate synthase complex subunit DHDDS (EC 2.5.1.87) (Cis-isoprenyltransferase) (CIT) (Cis-IPTase) (Cis-prenyltransferase subunit hCIT) (Epididymis tissue protein Li 189m)

Protein Class (7)

Disease related genesEnzymesEssential proteinsHuman disease related genesMetabolic proteinsPotential drug targetsPredicted intracellular proteins

Protein Function (7)

Human disease related genes:Congenital disorders of metabolism:Congenital disorders of glycan/glycoprotein metabolism
Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
Enzymes
Disease related genes
Human disease related genes:Nervous system diseases:Eye disease

Ensembl

ENSG00000117682

Entrez Gene Symbol

DHDDS

Gene Synonym (5)

DSFLJ13102hCITHDSRP59

Gene Description

Dehydrodolichyl diphosphate synthase subunit

Chromosome

Position

26432282-26471306

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization2

Cell SpecificBasal keratinocytes

Function & Pathway7

Protein Function (7)

Human disease related genes:Congenital disorders of metabolism:Congenital disorders of glycan/glycoprotein metabolism
Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
Enzymes
Disease related genes
Human disease related genes:Nervous system diseases:Eye disease

Cellular Component (3)

Molecular Function (4)

Biological Process (3)

KEGG

hsa00900 Terpenoid backbone biosynthesis

Reactome (8)

Mediation Categories (2)

Clinical-translation mediationMetabolism mediation

Relations & Evidence10

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (5)

5 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
DHDDS-NUS1 complex	DHDDS NUS1	Q86SQ9 Q96E22	2:2	KEGG-MEDICUSCORUMComplexPortalhu.MAP2PDB	PDB:7paxPDB:7payPDB:6z1nPDB:6w2lPDB:6Z1NPDB:7pb0CORUM:6238intact:EBI-26971796PDB:7pb1	25066056 21572394 33077723 14755292 32817466
	ABHD2 AGPAT2 ALYREF DHDDS LIPA LSS SLC27A3 UBC	O15120 P08910 P0CG48 P38571 P48449 Q5K4L6 Q86SQ9 Q86V81	1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8811
	ABHD2 AGPAT2 ALYREF DHDDS LIPA LSS SLC27A4 UBC	O15120 P08910 P0CG48 P38571 P48449 Q6P1M0 Q86SQ9 Q86V81	1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5118
	ABHD2 AGPAT2 ALYREF DHDDS LIPA LSS SLC27A6 UBC	O15120 P08910 P0CG48 P38571 P48449 Q86SQ9 Q86V81 Q9Y2P4	1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9623
	DHDDS FOXP4 NUS1	Q86SQ9 Q8IVH2 Q96E22	0:0:0	hu.MAP

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
	Mass spectrometryR Sequencing	0

Sequence, Structure & Domains12

Sequences

Length

333

Mass

38,657

Sequence

MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q86SQ9-1; Sequence=Displayed; Name=2; IsoId=Q86SQ9-2; Sequence=VSP_010031; Name=3; IsoId=Q86SQ9-3; Sequence=VSP_010030; Name=4; IsoId=Q86SQ9-4; Sequence=VSP_045007

Alternative Sequence

109..147; Missing (in isoform 3); 147..181; KCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPS -> N (in isoform 4); 255; Q -> QQ (in isoform 2)

3D Structural Models

Turn

2..4; 107..109; 193..196; 217..222

Helix

11..20; 36..42; 47..67; 80..84; 87..106; 110..113; 124..126; 129..142; 158..174; 180..182; 185..189; 232..234; 237..282; 283..285; 294..322; 325..327

Beta Strand

27..32; 72..79; 116..122; 147..156; 201..206; 214..216; 223..228

3D Structure

X-ray crystallography (6)

Domain & Motif Annotations

Domain (CC)

The catalytic site at NUS1-DHDDS interface accomodates both the allylic and the homoallylic IPP substrates to the S1 and S2 pockets respectively. The beta-phosphate groups of IPP substrates form hydrogen bonds with the RXG motif of NUS1 and four conserved residues of DHDDS (Arg-85, Arg-205, Arg-211 and Ser-213), while the allylic isopentenyl group is pointed toward the hydrophobic tunnel of the S1 pocket where the product elongation occurs.

Protein Families

UPP synthase family

Sequence Similarities

Belongs to the UPP synthase family.

Clinical Relevance2

Disease Involvement (4)

Disease variantEpilepsyIntellectual disabilityRetinitis pigmentosa

Antibody (2)

HPA026721 HPA026727

Supporting Publications1

PMID	Title	Abstract
36028467	Plasma exosomal DOK3 reflects immunological states in lung tumor and predicts prognosis of gefitinib treatment.	No abstract available