Protein detail
ZN598
E3 ubiquitin-protein ligase ZNF598 (EC 2.3.2.27) (Zinc finger protein 598)
Entry name ZN598 | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Predicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
E3 ubiquitin-protein ligase ZNF598 (EC 2.3.2.27) (Zinc finger protein 598)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
FLJ00086HEL2
Gene Description
Zinc finger protein 598, E3 ubiquitin ligase
Chromosome
16
Position
1997654-2009821
Supporting publications (n)
2
EVMP confidence score
0.28
Fluorescence & Localization
Tissue SpecifickidneyCell SpecificProximal tubule cells
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (2)
Molecular Function (7)
Mediation Categories
Other mediation
Relations & Evidence151
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ZNF598 | EGF | P01133 | Y | 289 | phosphorylation | BEL-Large-Corpus_ProtMapperProtMapper | ProtMapper:17081983 |
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath |
Regulatory Interaction Network (136)
136 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| COMPLEX:P0CG47_P61077 | ZN598 | Q86UK7 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P61088_P62979 | ZN598 | Q86UK7 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P51965_P62987 | ZN598 | Q86UK7 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P62979_Q13404 | ZN598 | Q86UK7 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P0CG48_Q9H832 | ZN598 | Q86UK7 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P62256_P62979 | ZN598 | Q86UK7 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:A0A1B0GUS4_P62979 | ZN598 | Q86UK7 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P61088_P62987 | ZN598 | Q86UK7 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P61077_P62979 | ZN598 | Q86UK7 | Yes | Yes | SIGNOR | SIGNOR:34199813 | ||
| COMPLEX:P62979_Q712K3 | ZN598 | Q86UK7 | Yes | Yes | SIGNOR | SIGNOR:34199813 |
Protein Complex Composition (9)
9 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| 4EHP-GIGYF1 co-translational mRNA decay complexZNF598 variant | EIF4E2GIGYF1ZNF598 | O60573O75420Q86UK7 | 1:1:1 | ComplexPortal | PDB:5nvk | 147552923305335528698298 |
| 4EHP-GIGYF2 co-translational mRNA decay complexZNF598 variant | EIF4E2GIGYF2ZNF598 | O60573Q6Y7W6Q86UK7 | 1:1:1 | ComplexPortal | 147552923305335528698298 | |
| Ub:RING_E3 | UBBZNF598 | P0CG47Q86UK7 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| Ub:RING_E3 | UBCZNF598 | P0CG48Q86UK7 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| Ub:RING_E3 | RPS27AZNF598 | P62979Q86UK7 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| Ub:RING_E3 | UBA52ZNF598 | P62987Q86UK7 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C519 | |
| GTF2F1GTF2F2IWS1POLR2APOLR2BPOLR2CPOLR2EPOLR2GPOLR2HPOLR2JSUPT5HSUPT6HTCEA1UBCZNF598 | O00267P0CG48P13984P19387P19388P23193P24928P30876P35269P52434P52435P62487Q7KZ85Q86UK7Q96ST2 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7916 | ||
| CUTCEDF1ERCC4GALNT4POC1BXPAZNF598 | O60869P23025Q86UK7Q8N4A0Q8TC44Q92889Q9NTM9 | 0:0:0:0:0:0:0 | hu.MAP2 | |||
| GALNT4POC1BZNF598 | Q86UK7Q8N4A0Q8TC44 | 0:0:0 | hu.MAP2 |
Sequence, Structure & Domains
Sequences
Length
904
Mass
98,637
Sequence
MAAAGGAEGRRAALEAAAAAAPERGGGSCVLCCGDLEATALGRCDHPVCYRCSTKMRVLCEQRYCAVCREELRQVVFGKKLPAFATIPIHQLQHEKKYDIYFADGKVYALYRQLLQHECPRCPELPPFSLFGDLEQHMRRQHELFCCRLCLQHLQIFTYERKWYSRKDLARHRMQGDPDDTSHRGHPLCKFCDERYLDNDELLKHLRRDHYFCHFCDSDGAQDYYSDYAYLREHFREKHFLCEEGRCSTEQFTHAFRTEIDLKAHRTACHSRSRAEARQNRHIDLQFSYAPRHSRRNEGVVGGEDYEEVDRYSRQGRVARAGTRGAQQSRRGSWRYKREEEDREVAAAVRASVAAQQQEEARRSEDQEEGGRPKKEEAAARGPEDPRGPRRSPRTQGEGPGPKETSTNGPVSQEAFSVTGPAAPGCVGVPGALPPPSPKLKDEDFPSLSASTSSSCSTAATPGPVGLALPYAIPARGRSAFQEEDFPALVSSVPKPGTAPTSLVSAWNSSSSSKKVAQPPLSAQATGSGQPTRKAGKGSRGGRKGGPPFTQEEEEDGGPALQELLSTRPTGSVSSTLGLASIQPSKVGKKKKVGSEKPGTTLPQPPPATCPPGALQAPEAPASRAEGPVAVVVNGHTEGPAPARSAPKEPPGLPRPLGSFPCPTPQEDFPALGGPCPPRMPPPPGFSAVVLLKGTPPPPPPGLVPPISKPPPGFSGLLPSPHPACVPSPATTTTTKAPRLLPAPRAYLVPENFRERNLQLIQSIRDFLQSDEARFSEFKSHSGEFRQGLISAAQYYKSCRDLLGENFQKVFNELLVLLPDTAKQQELLSAHTDFCNREKPLSTKSKKNKKSAWQATTQQAGLDCRVCPTCQQVLAHGDASSHQALHAARDDDFPSLQAIARIIT
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q86UK7-1; Sequence=Displayed; Name=2; IsoId=Q86UK7-2; Sequence=VSP_020661, VSP_020663, VSP_020664; Name=3; IsoId=Q86UK7-3; Sequence=VSP_020663; Name=4; IsoId=Q86UK7-4; Sequence=VSP_020660, VSP_020662, VSP_020664, VSP_020665
Alternative Sequence
1..397; Missing (in isoform 4); 335..337; Missing (in isoform 2); 398..431; EGPGPKETSTNGPVSQEAFSVTGPAAPGCVGVPG -> MVGGCGQPQVGAGRAGMEPRGLIAVDQLCFPAPS (in isoform 4); 424..429; Missing (in isoform 2 and isoform 3); 551; Q -> QE (in isoform 2 and isoform 4); 738..904; Missing (in isoform 4)
Domain & Motif Annotations
Compositional Bias
346..358; Low complexity; 359..388; Basic and acidic residues; 404..416; Polar residues; 418..431; Low complexity; 447..461; Low complexity; 502..513; Low complexity; 521..531; Polar residues; 534..543; Basic residues; 564..584; Polar residues
Zinc Finger
29..69; RING-type; 187..210; C2H2-type
Region
312..469; Disordered; 490..656; Disordered
Protein Families
ZNF598/HEL2 family
Sequence Similarities
Belongs to the ZNF598/HEL2 family.
Clinical Relevance
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 37922300 | Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women. | No related sentences available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No related sentences available |