Protein detail
ZN227
Zinc finger protein 227
Entry name ZN227 | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Plasma proteinsPredicted intracellular proteinsTranscription factors |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Zinc finger protein 227
Protein Class (3)
Plasma proteinsPredicted intracellular proteinsTranscription factors
Protein Function (2)
- Predicted intracellular proteins
- Transcription factors:Zinc-coordinating DNA-binding domains
Ensembl
Entrez Gene Symbol
Gene Description
Zinc finger protein 227
Chromosome
19
Position
44207547-44237268
Supporting publications (n)
1
EVMP confidence score
0.28
Fluorescence & Localization
Cell SpecificEarly spermatids
Function & Pathway
Protein Function (2)
- Predicted intracellular proteins
- Transcription factors:Zinc-coordinating DNA-binding domains
Cellular Component
Molecular Function (4)
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence6
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath |
Protein Complex Composition (1)
Sequence, Structure & Domains
Sequences
Length
799
Mass
92,033
Sequence
MPSQNYDLPQKKQEKMTKFQEAVTFKDVAVVFSREELRLLDLTQRKLYRDVMVENFKNLVAVGHLPFQPDMVSQLEAEEKLWMMETETQRSSKHQNKMETLQKFALKYLSNQELSCWQIWKQVASELTRCLQGKSSQLLQGDSIQVSENENNIMNPKGDSSIYIENQEFPFWRTQHSCGNTYLSESQIQSRGKQIDVKNNLQIHEDFMKKSPFHEHIKTDTEPKPCKGNEYGKIISDGSNQKLPLGEKPHPCGECGRGFSYSPRLPLHPNVHTGEKCFSQSSHLRTHQRIHPGEKLNRCHESGDCFNKSSFHSYQSNHTGEKSYRCDSCGKGFSSSTGLIIHYRTHTGEKPYKCEECGKCFSQSSNFQCHQRVHTEEKPYKCEECGKGFGWSVNLRVHQRVHRGEKPYKCEECGKGFTQAAHFHIHQRVHTGEKPYKCDVCGKGFSHNSPLICHRRVHTGEKPYKCEACGKGFTRNTDLHIHFRVHTGEKPYKCKECGKGFSQASNLQVHQNVHTGEKRFKCETCGKGFSQSSKLQTHQRVHTGEKPYRCDVCGKDFSYSSNLKLHQVIHTGEKPYKCEECGKGFSWRSNLHAHQRVHSGEKPYKCEQCDKSFSQAIDFRVHQRVHTGEKPYKCGVCGKGFSQSSGLQSHQRVHTGEKPYKCDVCGKGFRYSSQFIYHQRGHTGEKPYKCEECGKGFGRSLNLRHHQRVHTGEKPHICEECGKAFSLPSNLRVHLGVHTREKLFKCEECGKGFSQSARLEAHQRVHTGEKPYKCDICDKDFRHRSRLTYHQKVHTGKKL
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q86WZ6-1; Sequence=Displayed; Name=2; IsoId=Q86WZ6-2; Sequence=VSP_056544
Alternative Sequence
1..51; Missing (in isoform 2)
Domain & Motif Annotations
Zinc Finger
250..272; C2H2-type 1; 269..291; C2H2-type 2; 324..346; C2H2-type 3; 352..374; C2H2-type 4; 380..402; C2H2-type 5; 408..430; C2H2-type 6; 436..458; C2H2-type 7; 464..486; C2H2-type 8; 492..514; C2H2-type 9; 520..542; C2H2-type 10; 548..570; C2H2-type 11; 576..598; C2H2-type 12; 604..626; C2H2-type 13; 632..654; C2H2-type 14; 660..682; C2H2-type 15; 688..710; C2H2-type 16; 716..738; C2H2-type 17; 744..766; C2H2-type 18; 772..794; C2H2-type 19
Domain (FT)
23..94; KRAB
Protein Families
Krueppel C2H2-type zinc-finger protein family
Sequence Similarities
Belongs to the krueppel C2H2-type zinc-finger protein family.
Clinical Relevance
Antibody
Interaction Protein
ENSG00000130726
Interaction Count
1
Interaction Dataset
biogrid_bioplex
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 34265469 | Proteomic Landscape of Exosomes Reveals the Functional Contributions of CD151 in Triple-Negative Breast Cancer. | Furthermore, utilizing quantitative proteomics approach to reveal the proteomes of CD151-deleted exosomes and cells, we found that exosomal CD151 facilitated secretion of ribosomal proteins via exosomes while inhibiting exosome secretion of complement proteins. Moreover, we proved that CD151-deleted exosomes significantly decreased the migration and invasion of TNBC cells. Most importantly, we found that the tetraspanin CD151 expression levels in TNBC-derived serum exosomes were significantly higher than those exosomes from healthy subjects, and we validated our findings with samples from 16 additional donors. This is the first comparative study of the proteomes of TNBC patient-derived and CD151-deleted exosomes. |