Protein detail

ZN227

Zinc finger protein 227

Entry name ZN227	UniProt ID Q86WZ6	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteinsTranscription factors

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information10

Protein Names

Zinc finger protein 227

Protein Class (3)

Plasma proteinsPredicted intracellular proteinsTranscription factors

Protein Function (2)

Predicted intracellular proteins
Transcription factors:Zinc-coordinating DNA-binding domains

Ensembl

ENSG00000131115

Entrez Gene Symbol

ZNF227

Gene Description

Zinc finger protein 227

Chromosome

Position

44207547-44237268

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization1

Cell SpecificEarly spermatids

Function & Pathway6

Protein Function (2)

Predicted intracellular proteins
Transcription factors:Zinc-coordinating DNA-binding domains

Cellular Component

GO:0005634 nucleus

Molecular Function (4)

Biological Process (3)

Reactome

R-hsa-73857 rna polymerase ii transcription

Mediation Categories

Other mediation

Relations & Evidence6

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	MAP3K20 ZNF227 ZNF544	Q6NX49 Q86WZ6 Q9NYL2	0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	3	40985879 37322475 38207106

Sequence, Structure & Domains9

Sequences

Length

799

Mass

92,033

Sequence

MPSQNYDLPQKKQEKMTKFQEAVTFKDVAVVFSREELRLLDLTQRKLYRDVMVENFKNLVAVGHLPFQPDMVSQLEAEEKLWMMETETQRSSKHQNKMETLQKFALKYLSNQELSCWQIWKQVASELTRCLQGKSSQLLQGDSIQVSENENNIMNPKGDSSIYIENQEFPFWRTQHSCGNTYLSESQIQSRGKQIDVKNNLQIHEDFMKKSPFHEHIKTDTEPKPCKGNEYGKIISDGSNQKLPLGEKPHPCGECGRGFSYSPRLPLHPNVHTGEKCFSQSSHLRTHQRIHPGEKLNRCHESGDCFNKSSFHSYQSNHTGEKSYRCDSCGKGFSSSTGLIIHYRTHTGEKPYKCEECGKCFSQSSNFQCHQRVHTEEKPYKCEECGKGFGWSVNLRVHQRVHRGEKPYKCEECGKGFTQAAHFHIHQRVHTGEKPYKCDVCGKGFSHNSPLICHRRVHTGEKPYKCEACGKGFTRNTDLHIHFRVHTGEKPYKCKECGKGFSQASNLQVHQNVHTGEKRFKCETCGKGFSQSSKLQTHQRVHTGEKPYRCDVCGKDFSYSSNLKLHQVIHTGEKPYKCEECGKGFSWRSNLHAHQRVHSGEKPYKCEQCDKSFSQAIDFRVHQRVHTGEKPYKCGVCGKGFSQSSGLQSHQRVHTGEKPYKCDVCGKGFRYSSQFIYHQRGHTGEKPYKCEECGKGFGRSLNLRHHQRVHTGEKPHICEECGKAFSLPSNLRVHLGVHTREKLFKCEECGKGFSQSARLEAHQRVHTGEKPYKCDICDKDFRHRSRLTYHQKVHTGKKL

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q86WZ6-1; Sequence=Displayed; Name=2; IsoId=Q86WZ6-2; Sequence=VSP_056544

Alternative Sequence

1..51; Missing (in isoform 2)

Domain & Motif Annotations

Zinc Finger

250..272; C2H2-type 1; 269..291; C2H2-type 2; 324..346; C2H2-type 3; 352..374; C2H2-type 4; 380..402; C2H2-type 5; 408..430; C2H2-type 6; 436..458; C2H2-type 7; 464..486; C2H2-type 8; 492..514; C2H2-type 9; 520..542; C2H2-type 10; 548..570; C2H2-type 11; 576..598; C2H2-type 12; 604..626; C2H2-type 13; 632..654; C2H2-type 14; 660..682; C2H2-type 15; 688..710; C2H2-type 16; 716..738; C2H2-type 17; 744..766; C2H2-type 18; 772..794; C2H2-type 19

Domain (FT)

23..94; KRAB

Protein Families

Krueppel C2H2-type zinc-finger protein family

Sequence Similarities

Belongs to the krueppel C2H2-type zinc-finger protein family.

Clinical Relevance4

Antibody

HPA030573

Interaction Protein

ENSG00000130726

Interaction Count

Interaction Dataset

biogrid_bioplex

Supporting Publications1

PMID	Title	Abstract
34265469	Proteomic Landscape of Exosomes Reveals the Functional Contributions of CD151 in Triple-Negative Breast Cancer.	Furthermore, utilizing quantitative proteomics approach to reveal the proteomes of CD151-deleted exosomes and cells, we found that exosomal CD151 facilitated secretion of ribosomal proteins via exosomes while inhibiting exosome secretion of complement proteins. Moreover, we proved that CD151-deleted exosomes significantly decreased the migration and invasion of TNBC cells. Most importantly, we found that the tetraspanin CD151 expression levels in TNBC-derived serum exosomes were significantly higher than those exosomes from healthy subjects, and we validated our findings with samples from 16 additional donors. This is the first comparative study of the proteomes of TNBC patient-derived and CD151-deleted exosomes.