Protein detail

LSR

Lipolysis-stimulated lipoprotein receptor (Angulin-1)

Entry name LSR	UniProt ID Q86X29	EVMP score 0.50
Frequency 1	Transmembrane count 1	Protein classification Disease related genesPredicted intracellular proteinsPredicted membrane proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Lipolysis-stimulated lipoprotein receptor (Angulin-1)

Protein Class

Disease related genesPredicted intracellular proteinsPredicted membrane proteins

Protein Function

Disease related genes
Predicted intracellular proteins

Transmembrane

260..280; Helical

Transmembrane Count

Ensembl

ENSG00000105699

Entrez Gene Symbol

LSR

Gene Synonym

ILDR3LISCH7

Gene Description

Lipolysis stimulated lipoprotein receptor

Chromosome

Position

35248330-35267964

Frequency

EVMP Score

0.50

Fluorescence & Localization

Tissue Specificlymphoid tissueCell SpecificB-cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificmemory B-cellBlood Lineage SpecificB-cells

Function & Pathway

Protein Function

Disease related genes
Predicted intracellular proteins

Cellular Component

Biological Process

Reactome

Canonical Pathways

M11 Pid prl signaling events pathway

Mediation Categories

Adhesion and uptake mediationFusion and delivery mediation

Relations & Evidence

Enzyme-Mediated Modification

2 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
LSR	FGFR1	P11362	Y	615	phosphorylation	PhosphoNetworks
LSR	FGFR1	P11362	Y	616	phosphorylation	PhosphoNetworks

Ligand-Receptor Signaling

37 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	ICELLNET	No	Yes	No	Yes	No
receptor	receptor	CellTalkDB	No	Yes	No	Yes	No
receptor	receptor	Ramilowski2015	No	Yes	No	Yes	No
receptor	receptor	LRdb	No	Yes	No	Yes	No
receptor	receptor	Baccin2019	No	Yes	No	Yes	No
receptor	receptor	OmniPath	No	Yes	No	Yes	No
intracellular	intracellular	ComPPI	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	No	Yes	No
adhesion	adhesion	OmniPath	Yes	Yes	No	Yes	No

Page 1 of 4Next

Regulatory Interaction Network

0 records.

Protein Complex Composition

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	LEMD3 LSR SMAD2 SMAD3 SMAD9 ZFYVE9	O15198 O95405 P84022 Q15796 Q86X29 Q9Y2U8	0:0:0:0:0:0	hu.MAP2

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Size Exclusion Chromatography	Mass spectrometry	1	33204424

Sequence, Structure & Domains

Sequences

Length

649

Mass

71,439

Sequence

MQQDGLGVGTRNGSGKGRSVHPSWPWCAPRPLRYFGRDARARRAQTAAMALLAGGLSRGLGSHPAAAGRDAVVFVWLLLSTWCTAPARAIQVTVSNPYHVVILFQPVTLPCTYQMTSTPTQPIVIWKYKSFCRDRIADAFSPASVDNQLNAQLAAGNPGYNPYVECQDSVRTVRVVATKQGNAVTLGDYYQGRRITITGNADLTFDQTAWGDSGVYYCSVVSAQDLQGNNEAYAELIVLGRTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGICWCQCCPHTCCCYVRCPCCPDKCCCPEALYAAGKAATSGVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYNGYPGGYPGDVDRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSMRVLYYMEKELANFDPSRPGPPSGRVERAMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQAGGGWRARRPRARSVDALDDLTPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDSRDFPRSRDPHYDDFRSRERPPADPRSHHHRTRDPRDNGSRSGDLPYDGRLLEEAVRKKGSEERRRPHKEEEEEAYYPPAPPPYSETDSQASRERRLKKNLALSRESLVV

Alternative Products

Event=Alternative splicing; Named isoforms=6; Name=1; IsoId=Q86X29-1; Sequence=Displayed; Name=2; IsoId=Q86X29-2; Sequence=VSP_019691, VSP_019693; Name=3; IsoId=Q86X29-3; Sequence=VSP_019692, VSP_019694; Name=4; IsoId=Q86X29-4; Sequence=VSP_019692; Name=5; IsoId=Q86X29-5; Sequence=VSP_046797; Name=6; IsoId=Q86X29-6; Sequence=VSP_057210, VSP_057211

Alternative Sequence

1..48; Missing (in isoform 6); 52..88; Missing (in isoform 2); 200..308; NADLTFDQTAWGDSGVYYCSVVSAQDLQGNNEAYAELIVLGRTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGICWCQCCPHTCCCYVRCPCCPDKCCCPEAL -> M (in isoform 6); 240..308; GRTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGICWCQCCPHTCCCYVRCPCCPDKCCCPEAL -> V (in isoform 5); 240..258; Missing (in isoform 3 and isoform 4); 366..386; Missing (in isoform 2); 386; Missing (in isoform 3)

3D Structural Models

Domain & Motif Annotations

Compositional Bias

1..16; Gly residues; 426..444; Basic and acidic residues; 502..518; Polar residues; 529..565; Basic and acidic residues; 589..609; Basic and acidic residues

Domain (FT)

86..234; Ig-like V-type

Region

1..21; Disordered; 414..649; Disordered

Protein Families

Immunoglobulin superfamily
LISCH7 family

Sequence Similarities

Belongs to the immunoglobulin superfamily. LISCH7 family.

Clinical Relevance

Antibody

HPA007270 HPA075309

Interaction Protein

ENSG00000166913ENSG00000170027

Interaction Count

Interaction Dataset

intact_biogrid