Protein detail
LSR
Lipolysis-stimulated lipoprotein receptor (Angulin-1)
Entry name LSR | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Disease related genesPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Lipolysis-stimulated lipoprotein receptor (Angulin-1)
Protein Class (3)
Disease related genesPredicted intracellular proteinsPredicted membrane proteins
Protein Function (2)
- Disease related genes
- Predicted intracellular proteins
Transmembrane
260..280; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
ILDR3LISCH7
Gene Description
Lipolysis stimulated lipoprotein receptor
Chromosome
19
Position
35248330-35267964
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization6
Tissue Specificlymphoid tissueCell SpecificB-cellsSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificmemory B-cellBlood Lineage SpecificB-cells
Function & Pathway6
Protein Function (2)
- Disease related genes
- Predicted intracellular proteins
Cellular Component (9)
Biological Process (3)
Reactome (5)
Canonical Pathways
M11 Pid prl signaling events pathway
Mediation Categories (2)
Adhesion and uptake mediationFusion and delivery mediation
Relations & Evidence41
Enzyme-Mediated Modification (2)
Ligand-Receptor Signaling (37)
37 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | connectomeDB2020 | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| receptor | receptor | talklr | No | Yes | No | Yes | No |
| receptor | receptor | Cellinker | No | Yes | No | Yes | No |
| receptor | receptor | connectomeDB2020 | No | Yes | No | Yes | No |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Size Exclusion Chromatography | Mass spectrometry | 1 | 33204424 |
Sequence, Structure & Domains10
Sequences
Length
649
Mass
71,439
Sequence
MQQDGLGVGTRNGSGKGRSVHPSWPWCAPRPLRYFGRDARARRAQTAAMALLAGGLSRGLGSHPAAAGRDAVVFVWLLLSTWCTAPARAIQVTVSNPYHVVILFQPVTLPCTYQMTSTPTQPIVIWKYKSFCRDRIADAFSPASVDNQLNAQLAAGNPGYNPYVECQDSVRTVRVVATKQGNAVTLGDYYQGRRITITGNADLTFDQTAWGDSGVYYCSVVSAQDLQGNNEAYAELIVLGRTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGICWCQCCPHTCCCYVRCPCCPDKCCCPEALYAAGKAATSGVPSIYAPSTYAHLSPAKTPPPPAMIPMGPAYNGYPGGYPGDVDRSSSAGGQGSYVPLLRDTDSSVASEVRSGYRIQASQQDDSMRVLYYMEKELANFDPSRPGPPSGRVERAMSEVTSLHEDDWRSRPSRGPALTPIRDEEWGGHSPRSPRGWDQEPAREQAGGGWRARRPRARSVDALDDLTPPSTAESGSRSPTSNGGRSRAYMPPRSRSRDDLYDQDDSRDFPRSRDPHYDDFRSRERPPADPRSHHHRTRDPRDNGSRSGDLPYDGRLLEEAVRKKGSEERRRPHKEEEEEAYYPPAPPPYSETDSQASRERRLKKNLALSRESLVV
Alternative Products
Event=Alternative splicing; Named isoforms=6; Name=1; IsoId=Q86X29-1; Sequence=Displayed; Name=2; IsoId=Q86X29-2; Sequence=VSP_019691, VSP_019693; Name=3; IsoId=Q86X29-3; Sequence=VSP_019692, VSP_019694; Name=4; IsoId=Q86X29-4; Sequence=VSP_019692; Name=5; IsoId=Q86X29-5; Sequence=VSP_046797; Name=6; IsoId=Q86X29-6; Sequence=VSP_057210, VSP_057211
Alternative Sequence
1..48; Missing (in isoform 6); 52..88; Missing (in isoform 2); 200..308; NADLTFDQTAWGDSGVYYCSVVSAQDLQGNNEAYAELIVLGRTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGICWCQCCPHTCCCYVRCPCCPDKCCCPEAL -> M (in isoform 6); 240..308; GRTSGVAELLPGFQAGPIEDWLFVVVVCLAAFLIFLLLGICWCQCCPHTCCCYVRCPCCPDKCCCPEAL -> V (in isoform 5); 240..258; Missing (in isoform 3 and isoform 4); 366..386; Missing (in isoform 2); 386; Missing (in isoform 3)
Domain & Motif Annotations
Compositional Bias
1..16; Gly residues; 426..444; Basic and acidic residues; 502..518; Polar residues; 529..565; Basic and acidic residues; 589..609; Basic and acidic residues
Domain (FT)
86..234; Ig-like V-type
Region
1..21; Disordered; 414..649; Disordered
Protein Families (2)
- Immunoglobulin superfamily
- LISCH7 family
Sequence Similarities
Belongs to the immunoglobulin superfamily. LISCH7 family.
Clinical Relevance4
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 30550287 | Label-Free Proteomic Analysis of Exosomes Secreted from THP-1-Derived Macrophages Treated with IFN-α Identifies Antiviral Proteins Enriched in Exosomes. | No abstract available |