Protein detail
CNGA4
Cyclic nucleotide-gated channel alpha-4 (CNG channel alpha-4) (CNGa4) (Olfactory cyclic nucleotide-gated channel subunit 2) (OCNC2)
Entry name CNGA4 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Cyclic nucleotide-gated channel alpha-4 (CNG channel alpha-4) (CNGa4) (Olfactory cyclic nucleotide-gated channel subunit 2) (OCNC2)
Protein Function
Voltage-gated ion channels:Cyclic Nucleotide-Regulated Channels
Transmembrane
39..60; Helical; Name=S1; 71..91; Helical; Name=S2; 117..135; Helical; Name=S3; 141..159; Helical; Name=S4; 167..190; Helical; Name=S5; 214..248; Helical; Name=P-helix; 249..273; Helical; Name=S6
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization1
Function & Pathway7
Protein Function
Voltage-gated ion channels:Cyclic Nucleotide-Regulated Channels
Cellular Component (5)
Molecular Function (6)
Biological Process (3)
Reactome (6)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence26
Ligand-Receptor Signaling (25)
25 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | No | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | No | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | No | No |
| ion_channel | ion_channel | DGIdb | No | Yes | No | No | No |
| cyclic_nucleotide_gated | ion_channel | HGNC | No | Yes | No | No | No |
| ion_channel | ion_channel | HGNC | No | Yes | No | No | No |
Page 1 of 3Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Western blotting | 1 | 39408670 |
Sequence, Structure & Domains12
Sequences
Length
575
Mass
65,999
Sequence
MSQDTKVKTTESSPPAPSKARKLLPVLDPSGDYYYWWLNTMVFPVMYNLIILVCRACFPDLQHGYLVAWLVLDYTSDLLYLLDMVVRFHTGFLEQGILVVDKGRISSRYVRTWSFFLDLASLMPTDVVYVRLGPHTPTLRLNRFLRAPRLFEAFDRTETRTAYPNAFRIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQYLYSFYFSTLILTTVGDTPPPAREEEYLFMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLQHVNRKLERRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQNCEASLLEELVLKLQPQTYSPGEYVCRKGDIGQEMYIIREGQLAVVADDGITQYAVLGAGLYFGEISIINIKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQAQTIMEEKGREILLKMNKLDVNAEAAEIALQEATESRLRGLDQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWPMPEDLAEADDEGEPEEGTSKDEEGRASQEGPPGPE
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8IV77-1; Sequence=Displayed; Name=2; IsoId=Q8IV77-2; Sequence=VSP_039919, VSP_039920, VSP_039921
Alternative Sequence
1..40; Missing (in isoform 2); 424..456; NMSGNRRTANIKSLGYSDLFCLSKEDLREVLSE -> GYPSICSRDKDGWGRGEQQSPVLGPDSTSGLNF (in isoform 2); 457..575; Missing (in isoform 2)
Domain & Motif Annotations
Compositional Bias
544..556; Acidic residues; 557..566; Basic and acidic residues
Motif
292..302; IQ-type
Coiled Coil
493..547
Domain (CC)
The C-terminal coiled-coil domain mediates trimerization of CNGA subunits.
Region
164..272; Ion conduction pathway; 231..234; Selectivity filter; 274..350; C-linker; 354..474; Cyclic nucleotide-binding domain; 538..575; Disordered
Protein Families (2)
- Cyclic nucleotide-gated cation channel (TC 1.A.1.5) family
- CNGA4 subfamily
Sequence Similarities
Belongs to the cyclic nucleotide-gated cation channel (TC 1.A.1.5) family. CNGA4 subfamily.
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 21630462 | Proteomic analysis of microvesicles derived from human colorectal cancer ascites. | No abstract available |