Protein detail

FBX16

F-box only protein 16

Entry name FBX16	UniProt ID Q8IX29	EVMP confidence score 0.38
Supporting publications (n) 4	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

F-box only protein 16

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000214050

Entrez Gene Symbol

FBXO16

Gene Synonym

FBX16

Gene Description

F-box protein 16

Chromosome

Position

28348287-28490278

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization2

Tissue SpecifictestisCell SpecificCardiomyocytes

Function & Pathway5

Protein Function

Predicted intracellular proteins

Molecular Function

GO:0005515 protein binding

Biological Process (3)

Canonical Pathways

M219 Pid hedgehog gli pathway

Mediation Categories

Other mediation

Relations & Evidence5

Ligand-Receptor Signaling (2)

2 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
SCF E3 ubiquitin ligase complexFBXO16 variant	CUL1 FBXO16 RBX1 SKP1	P62877 P63208 Q13616 Q8IX29	1:1:1:1	ComplexPortal	intact:EBI-44447841PDB:1LDJ	14755292 15520277 34445249
	CCDC191 CETN1 DNAAF4 EFCAB11 FAM156A FBXO16 MCM3AP PKN2 POC5 SFI1 SGSM1 SGSM2 TWIST1	A8K8P3 O43147 O60318 Q12798 Q15672 Q16513 Q2NKQ1 Q8IX29 Q8NA72 Q8NCU4 Q8NDB6 Q8WXU2 Q9BUY7	0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow Filtration	Mass spectrometry	3	38225453 32795414 38490958

Sequence, Structure & Domains8

Sequences

Length

292

Mass

34,588

Sequence

MMAFAPPKNTDGPKMQTKMSTWTPLNHQLLNDRVFEERRALLGKWFDKWTDSQRRRILTGLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLAELDQLWMLKCLRFNWYINFSPTPFEQGIWKKHYIQMVKELHITKPKTPPKDGFVIADVQLVTSNSPEEKQSPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMETVQQGRRKRNQMTPDFSRQSHDKKNKLQDRTRLRKAQSMMSRRNPFPLCP

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8IX29-1; Sequence=Displayed; Name=2; IsoId=Q8IX29-2; Sequence=VSP_045600

Alternative Sequence

34..45; Missing (in isoform 2)

Domain & Motif Annotations

Compositional Bias

194..204; Low complexity; 260..273; Basic and acidic residues

Domain (FT)

86..132; F-box

Region

188..224; Disordered; 238..292; Disordered

Clinical Relevance1

Antibody (2)

HPA058676 HPA076472

Supporting Publications4

PMID	Title	Abstract
37922300	Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women.	No abstract available
38731868	The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer.	No abstract available
39409015	SILAC-Based Characterization of Plasma-Derived Extracellular Vesicles in Patients Undergoing Partial Hepatectomy.	No abstract available
40098346	Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays.	No abstract available