Protein detail

NRSN1

Neurensin-1 (Neuro-p24) (Vesicular membrane protein of 24 kDa) (Vesicular membrane protein p24)

Entry name NRSN1	UniProt ID Q8IZ57	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count 2	Protein classification Predicted intracellular proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Neurensin-1 (Neuro-p24) (Vesicular membrane protein of 24 kDa) (Vesicular membrane protein p24)

Protein Class (3)

Predicted intracellular proteinsPredicted membrane proteinsTransporters

Protein Function (2)

Predicted intracellular proteins
Transporters:Accessory Factors Involved in Transport

Transmembrane

66..86; Helical; 120..140; Helical

Transmembrane Count

Ensembl

ENSG00000152954

Entrez Gene Symbol

NRSN1

Gene Synonym (2)

p24VMP

Gene Description

Neurensin 1

Chromosome

Position

24126186-24154900

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization1

Function & Pathway5

Protein Function (2)

Predicted intracellular proteins
Transporters:Accessory Factors Involved in Transport

Cellular Component (6)

Molecular Function

GO:0005515 protein binding

Biological Process (3)

Mediation Categories

Fusion and delivery mediation

Relations & Evidence22

Ligand-Receptor Signaling (20)

20 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	CellTalkDB	No	Yes	No	No	No
receptor	receptor	Ramilowski2015	No	Yes	No	No	No
receptor	receptor	LRdb	No	Yes	No	No	No
receptor	receptor	Baccin2019	No	Yes	No	No	No
receptor	receptor	OmniPath	No	Yes	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
transmembrane	transmembrane	UniProt_location	No	No	No	No	No
transmembrane	transmembrane	UniProt_topology	No	No	No	No	No

Page 1 of 2Next

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
TMP21-P24 complex	NRSN1 TMED10	P49755 Q8IZ57	1:1	Compleat	Compleat:HC358	16641999

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryR SequencingFlow cytometry	4	23161513 26801919 36635400 38490958

Sequence, Structure & Domains5

Sequences

Length

195

Mass

21,475

Sequence

MSSCSNVCGSRQAQAAAEGGYQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSSVFWKVGLISGTVFVILGLTVLAVGFLVPPKIEAFGEADFVVVDTHAVQFNSALDMYKLAGAVLFCIGGTSMAGCLLMSVFVKSYSKEEKFLQQKFKERIADIKAHTQPVTKAPGPGETKIPVTLSRVQNVQPLLAT

Domain & Motif Annotations

Protein Families

VMP family

Sequence Similarities

Belongs to the VMP family.

Clinical Relevance1

Antibody (2)

HPA019681 HPA061006

Supporting Publications1

PMID	Title	Abstract
32384937	Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles.	No abstract available