Protein detail
K319L
Dyslexia-associated protein KIAA0319-like protein (Adeno-associated virus receptor) (AAVR)
Entry name K319L | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 10 | Transmembrane count 2 | Protein classification Predicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Dyslexia-associated protein KIAA0319-like protein (Adeno-associated virus receptor) (AAVR)
Protein Class (2)
Predicted intracellular proteinsPredicted membrane proteins
Protein Function
Predicted intracellular proteins
Transmembrane
30..50; Helical; 933..953; Helical
Transmembrane Count
2
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
AAVRKIAA1837
Gene Description
KIAA0319 like
Chromosome
1
Position
35393883-35557950
Supporting publications (n)
10
EVMP confidence score
0.38
Function & Pathway5
Protein Function
Predicted intracellular proteins
Cellular Component (6)
Molecular Function
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence23
Ligand-Receptor Signaling (22)
22 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | UniProt_location | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | Yes | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
Page 1 of 3Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 27605433 |
Sequence, Structure & Domains10
Sequences
Length
1,049
Mass
115,658
Sequence
MEKRLGVKPNPASWILSGYYWQTSAKWLRSLYLFYTCFCFSVLWLSTDASESRCQQGKTQFGVGLRSGGENHLWLLEGTPSLQSCWAACCQDSACHVFWWLEGMCIQADCSRPQSCRAFRTHSSNSMLVFLKKFQTADDLGFLPEDDVPHLLGLGWNWASWRQSPPRAALRPAVSSSDQQSLIRKLQKRGSPSDVVTPIVTQHSKVNDSNELGGLTTSGSAEVHKAITISSPLTTDLTAELSGGPKNVSVQPEISEGLATTPSTQQVKSSEKTQIAVPQPVAPSYSYATPTPQASFQSTSAPYPVIKELVVSAGESVQITLPKNEVQLNAYVLQEPPKGETYTYDWQLITHPRDYSGEMEGKHSQILKLSKLTPGLYEFKVIVEGQNAHGEGYVNVTVKPEPRKNRPPIAIVSPQFQEISLPTTSTVIDGSQSTDDDKIVQYHWEELKGPLREEKISEDTAILKLSKLVPGNYTFSLTVVDSDGATNSTTANLTVNKAVDYPPVANAGPNQVITLPQNSITLFGNQSTDDHGITSYEWSLSPSSKGKVVEMQGVRTPTLQLSAMQEGDYTYQLTVTDTIGQQATAQVTVIVQPENNKPPQADAGPDKELTLPVDSTTLDGSKSSDDQKIISYLWEKTQGPDGVQLENANSSVATVTGLQVGTYVFTLTVKDERNLQSQSSVNVIVKEEINKPPIAKITGNVVITLPTSTAELDGSKSSDDKGIVSYLWTRDEGSPAAGEVLNHSDHHPILFLSNLVEGTYTFHLKVTDAKGESDTDRTTVEVKPDPRKNNLVEIILDINVSQLTERLKGMFIRQIGVLLGVLDSDIIVQKIQPYTEQSTKMVFFVQNEPPHQIFKGHEVAAMLKSELRKQKADFLIFRALEVNTVTCQLNCSDHGHCDSFTKRCICDPFWMENFIKVQLRDGDSNCEWSVLYVIIATFVIVVALGILSWTVICCCKRQKGKPKRKSKYKILDATDQESLELKPTSRAGIKQKGLLLSSSLMHSESELDSDDAIFTWPDREKGKLLHGQNGSVPNGQTPLKARSPREEIL
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8IZA0-1; Sequence=Displayed; Name=2; IsoId=Q8IZA0-2; Sequence=VSP_032955; Name=3; IsoId=Q8IZA0-3; Sequence=VSP_032953, VSP_032954
Alternative Sequence
1..563; Missing (in isoform 3); 638; Q -> HFFFCR (in isoform 3); 989..1049; IKQKGLLLSSSLMHSESELDSDDAIFTWPDREKGKLLHGQNGSVPNGQTPLKARSPREEIL -> RGPGCQSF (in isoform 2)
3D Structural Models
Beta Strand
315..319; 326..328; 332..334; 348..350; 358..360; 362..365; 367..371; 374..382; 391..398; 415..420; 426..429; 434..437; 441..448; 461..465; 470..480; 482..484; 486..496; 607..610; 615..619; 625..627; 634..639; 644..647; 650..657; 660..671; 676..686
3D Structure
Electron microscopy (8); NMR spectroscopy (1)
Domain & Motif Annotations
Compositional Bias
1028..1037; Polar residues
Domain (FT)
49..127; MANSC; 312..401; PKD 1; 409..498; PKD 2; 504..594; PKD 3; 600..688; PKD 4; 694..785; PKD 5
Region
1022..1049; Disordered
Clinical Relevance1
Antibody
Supporting Publications10
| PMID | Title | Abstract |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No abstract available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No abstract available |
| 30646616 | Preferential Localization of MUC1 Glycoprotein in Exosomes Secreted by Non-Small Cell Lung Carcinoma Cells. | THBS1, ANXA6, HIST1H4A, COL18A1, MDK, SRGN, ENO1, TUBA4A, SLC3A2, GPI, MIF, MUC1, TALDO1, SLC7A5, ICAM1, HSP90AA1, G6PD, and LRP1 were found to be expressed in exosomes at more than 5-fold higher level as compared to total cellular membrane proteins. |
| 32089743 | Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism. | No abstract available |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No abstract available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No abstract available |
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No abstract available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No abstract available |
| 41216884 | Extracellular Vesicles From Multiple Sclerosis White Matter Exhibit Synaptic, Mitochondrial, Complement and Ageing-Related Pathway Dysregulation. | No abstract available |