Protein detail
NALCN
Sodium leak channel NALCN (CanIon) (Sodium leak channel non-selective protein) (Voltage gated channel-like protein 1)
Entry name NALCN | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count 24 | Protein classification Disease related genesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Sodium leak channel NALCN (CanIon) (Sodium leak channel non-selective protein) (Voltage gated channel-like protein 1)
Protein Class (7)
Disease related genesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (5)
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Transporter channels and pores
- Disease related genes
- Human disease related genes:Congenital malformations:Other congenital malformations
Transmembrane
37..57; Helical; Name=S1 of repeat I; 66..90; Helical; Name=S2 of repeat I; 107..129; Helical; Name=S3 of repeat I; 138..158; Helical; Voltage-sensor; Name=S4 of repeat I; 174..199; Helical; Name=S5 of repeat I; 295..322; Helical; Name=S6 of repeat I; 383..403; Helical; Name=S1 of repeat II; 417..439; Helical; Name=S2 of repeat II; 448..468; Helical; Name=S3 of repeat II; 473..492; Helical; Voltage-sensor; Name=S4 of repeat II; 503..530; Helical; Name=S5 of repeat II; 570..599; Helical; Name=S6 of repeat II; 887..906; Helical; Name=S1 of repeat III; 916..939; Helical; Name=S2 of repeat III; 948..972; Helical; Name=S3 of repeat III; 981..1003; Helical; Voltage-sensor; Name=S4 of repeat III; 1016..1039; Helical; Name=S5 of repeat III; 1130..1159; Helical; Name=S6 of repeat III; 1211..1227; Helical; Name=S1 of repeat IV; 1237..1260; Helical; Name=S2 of repeat IV; 1272..1293; Helical; Name=S3 of repeat IV; 1297..1318; Helical; Voltage-sensor; Name=S4 of repeat IV; 1332..1357; Helical; Name=S5 of repeat IV; 1421..1447; Helical; Name=S6 of repeat IV
Transmembrane Count
24
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
bA430M15.1CanIonVGCNL1
Gene Description
Sodium leak channel, non-selective
Chromosome
13
Position
101053776-101416508
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Cell SpecificExtravillous trophoblastsSingle-Nuclei Brain Specificcentral nervous system macrophageSecretome LocationIntracellular and membraneSecretome FunctionImmunity
Function & Pathway
Protein Function (5)
- Predicted intracellular proteins
- Potential drug targets
- Transporters:Transporter channels and pores
- Disease related genes
- Human disease related genes:Congenital malformations:Other congenital malformations
Cellular Component (2)
Molecular Function (5)
Biological Process (3)
Reactome (3)
Mediation Categories
Fusion and delivery mediation
Relations & Evidence26
Ligand-Receptor Signaling (24)
24 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| gpcr | receptor | DGIdb | Yes | ||||
| receptor | receptor | OmniPath | Yes | ||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | OmniPath | |||||
| ion_channel | ion_channel | DGIdb | Yes | ||||
| sodium_leak | ion_channel | HGNC | Yes | ||||
| ion_channel | ion_channel | HGNC | Yes | ||||
| transporter | transporter | OmniPath | Yes | ||||
| ion_channel | ion_channel | OmniPath | Yes | ||||
| transmembrane | transmembrane | UniProt_location |
Page 1 of 3Next
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| UNC80 | Q8N2C7 | NALCN | Q8IZF0 | Yes | Yes | HINTSIGNOR | HINT:35387979SIGNOR:22196327HINT:34929720SIGNOR:19535918 |
Sequence, Structure & Domains
Sequences
Length
1,738
Mass
200,331
Sequence
MLKRKQSSRVEAQPVTDFGPDESLSDNADILWINKPWVHSLLRICAIISVISVCMNTPMTFEHYPPLQYVTFTLDTLLMFLYTAEMIAKMHIRGIVKGDSSYVKDRWCVFDGFMVFCLWVSLVLQVFEIADIVDQMSPWGMLRIPRPLIMIRAFRIYFRFELPRTRITNILKRSGEQIWSVSIFLLFFLLLYGILGVQMFGTFTYHCVVNDTKPGNVTWNSLAIPDTHCSPELEEGYQCPPGFKCMDLEDLGLSRQELGYSGFNEIGTSIFTVYEAASQEGWVFLMYRAIDSFPRWRSYFYFITLIFFLAWLVKNVFIAVIIETFAEIRVQFQQMWGSRSSTTSTATTQMFHEDAAGGWQLVAVDVNKPQGRAPACLQKMMRSSVFHMFILSMVTVDVIVAASNYYKGENFRRQYDEFYLAEVAFTVLFDLEALLKIWCLGFTGYISSSLHKFELLLVIGTTLHVYPDLYHSQFTYFQVLRVVRLIKISPALEDFVYKIFGPGKKLGSLVVFTASLLIVMSAISLQMFCFVEELDRFTTFPRAFMSMFQILTQEGWVDVMDQTLNAVGHMWAPVVAIYFILYHLFATLILLSLFVAVILDNLELDEDLKKLKQLKQSEANADTKEKLPLRLRIFEKFPNRPQMVKISKLPSDFTVPKIRESFMKQFIDRQQQDTCCLLRSLPTTSSSSCDHSKRSAIEDNKYIDQKLRKSVFSIRARNLLEKETAVTKILRACTRQRMLSGSFEGQPAKERSILSVQHHIRQERRSLRHGSNSQRISRGKSLETLTQDHSNTVRYRNAQREDSEIKMIQEKKEQAEMKRKVQEEELRENHPYFDKPLFIVGREHRFRNFCRVVVRARFNASKTDPVTGAVKNTKYHQLYDLLGLVTYLDWVMIIVTICSCISMMFESPFRRVMHAPTLQIAEYVFVIFMSIELNLKIMADGLFFTPTAVIRDFGGVMDIFIYLVSLIFLCWMPQNVPAESGAQLLMVLRCLRPLRIFKLVPQMRKVVRELFSGFKEIFLVSILLLTLMLVFASFGVQLFAGKLAKCNDPNIIRREDCNGIFRINVSVSKNLNLKLRPGEKKPGFWVPRVWANPRNFNFDNVGNAMLALFEVLSLKGWVEVRDVIIHRVGPIHGIYIHVFVFLGCMIGLTLFVGVVIANFNENKGTALLTVDQRRWEDLKSRLKIAQPLHLPPRPDNDGFRAKMYDITQHPFFKRTIALLVLAQSVLLSVKWDVEDPVTVPLATMSVVFTFIFVLEVTMKIIAMSPAGFWQSRRNRYDLLVTSLGVVWVVLHFALLNAYTYMMGACVIVFRFFSICGKHVTLKMLLLTVVVSMYKSFFIIVGMFLLLLCYAFAGVVLFGTVKYGENINRHANFSSAGKAITVLFRIVTGEDWNKIMHDCMVQPPFCTPDEFTYWATDCGNYAGALMYFCSFYVIIAYIMLNLLVAIIVENFSLFYSTEEDQLLSYNDLRHFQIIWNMVDDKREGVIPTFRVKFLLRLLRGRLEVDLDKDKLLFKHMCYEMERLHNGGDVTFHDVLSMLSYRSVDIRKSLQLEELLAREQLEYTIEEEVAKQTIRMWLKKCLKRIRAKQQQSCSIIHSLRESQQQELSRFLNPPSIETTQPSEDTNANSQDNSMQPETSSQQQLLSPTLSDRGGSRQDAADAGKPQRKFGQWRLPSAPKPISHSVSSVNLRFGGRTTMKSVVCKMNPMTDAASCGSEVKKWWTRQLTVESDESGDDLLDI
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8IZF0-1; Sequence=Displayed; Name=2; IsoId=Q8IZF0-2; Sequence=VSP_030190, VSP_030191; Name=3; IsoId=Q8IZF0-3; Sequence=VSP_030188, VSP_030189
Alternative Sequence
216..218; NVT -> LSL (in isoform 3); 219..1738; Missing (in isoform 3); 589..668; ILLSLFVAVILDNLELDEDLKKLKQLKQSEANADTKEKLPLRLRIFEKFPNRPQMVKISKLPSDFTVPKIRESFMKQFID -> PPSLIRDLCGTQDACPSCLPLQPPNHLPGSQTLARLTHQALTTPPGMRSSQLFSKISLLLGICVAWESILGSLSLSHNLQ (in isoform 2); 669..1738; Missing (in isoform 2)
3D Structural Models
Turn
32..34; 309..311; 467..471; 553..555; 569..571; 912..914; 1040..1042; 1144..1146; 1292..1294; 1387..1390; 1412..1414; 1505..1507; 1522..1524
Helix
37..55; 58..63; 67..90; 108..129; 138..143; 146..149; 150..153; 156..158; 164..199; 219..221; 248..251; 255..258; 266..277; 282..292; 295..308; 312..333; 374..376; 378..381; 384..402; 417..446; 449..464; 475..480; 481..488; 490..499; 503..528; 540..552; 556..566; 572..588; 590..602; 606..615; 630..632; 633..636; 660..668; 714..717; 719..739; 818..829; 836..838; 847..855; 878..882; 887..903; 916..940; 953..971; 981..988; 989..994; 995..999; 1001..1011; 1014..1039; 1054..1056; 1101..1112; 1117..1127; 1130..1132; 1133..1143; 1147..1163; 1170..1184; 1198..1207; 1210..1223; 1224..1228; 1238..1262; 1264..1268; 1272..1291; 1297..1312; 1313..1316; 1319..1334; 1336..1356; 1375..1386; 1391..1397; 1420..1436; 1438..1453; 1464..1477; 1489..1496; 1499..1501; 1509..1521; 1530..1539; 1544..1547; 1550..1570; 1590..1601
Beta Strand
130..133; 160..162; 205..211; 231..236; 243..247; 262..265; 355..357; 409..411; 537..539; 647..649; 830..834; 908..910; 942..945; 949..952; 978..980; 1045..1048; 1059..1065; 1069..1071; 1082..1087; 1166..1168; 1233..1235; 1367..1370; 1459..1461; 1479..1481; 1482..1485; 1525..1529
3D Structure
Electron microscopy (5)
Domain & Motif Annotations
Compositional Bias
1613..1632; Polar residues; 1633..1648; Low complexity
Coiled Coil
795..830
Domain (CC)
Contains 24 transmembrane helices (TM) that form four homologous functional repeats connected by intracellular linkers. Each of the four internal repeats contains five hydrophobic transmembrane segments (S1, S2, S3, S5, S6) and one positively charged transmembrane segment (S4). S4 segments represent the voltage-sensor. S4 transmembrane segments lack some of the charged residues (K and R) found at every third position in the S4s of the NaV, CaV, and KV channels. Pore-forming loops (P loops) between S5 and S6 of each domain form an EEKE sodium- ion selectivity filter a mixture between the EEEE found in the CaVs and the DEKA of NaVs. Voltage-sensing domains (VSDs), formed by S1 to S4 of each domain, detect changes in membrane potential and induce the opening or closing of the ion-conducting pore domain, formed by S5 and S6..
Region
762..785; Disordered; 1611..1678; Disordered
Protein Families
NALCN family
Sequence Similarities
Belongs to the NALCN family.
Clinical Relevance
Disease Involvement (2)
Disease variantNeurodegeneration
Drugs (2)
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 37953466 | RAB31 in glioma-derived endothelial cells promotes glioma cell invasion via extracellular vesicle-mediated enrichment of MYO1C. | RAB31 in glioma-derived endothelial cells promotes glioma cell invasion via extracellular vesicle-mediated enrichment of MYO1C. |