Protein detail
CKLF4
CKLF-like MARVEL transmembrane domain-containing protein 4 (Chemokine-like factor superfamily member 4)
Entry name CKLF4 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 3 | Transmembrane count 4 | Protein classification Predicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
CKLF-like MARVEL transmembrane domain-containing protein 4 (Chemokine-like factor superfamily member 4)
Protein Class (2)
Predicted membrane proteinsTransporters
Protein Function
Transporters:Transporter channels and pores
Transmembrane
59..79; Helical; 85..105; Helical; 123..143; Helical; 151..171; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym
CKLFSF4
Gene Description
CKLF like MARVEL transmembrane domain containing 4
Chromosome
16
Position
66614750-66696743
Supporting publications (n)
3
EVMP confidence score
0.50
Function & Pathway5
Protein Function
Transporters:Transporter channels and pores
Cellular Component
Molecular Function
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence12
Ligand-Receptor Signaling (10)
10 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| receptor | receptor | CellCellInteractions | No | Yes | No | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CKLF4 | Q8IZR5 | PD1L1 | Q9NZQ7 | Yes | Yes | No | SIGNOR | SIGNOR:28813410 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry | 0 |
Sequence, Structure & Domains10
Sequences
Length
234
Mass
25,828
Sequence
MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFICIETIMACSPCEGLYFFEFVSCSAFVVTGVLLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVLAALNHRAGAEIAAVIFGFLATAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQLA
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8IZR5-1; Sequence=Displayed; Name=2; IsoId=Q8IZR5-2; Sequence=VSP_008261; Name=3; IsoId=Q8IZR5-3; Sequence=VSP_008260, VSP_008261
Alternative Sequence
34..62; Missing (in isoform 3); 209..234; Missing (in isoform 2 and isoform 3)
Domain & Motif Annotations
Compositional Bias
1..11; Acidic residues; 15..25; Low complexity
Domain (FT)
49..176; MARVEL
Region
1..38; Disordered
Protein Families
Chemokine-like factor family
Sequence Similarities
Belongs to the chemokine-like factor family.
Supporting Publications3
| PMID | Title | Abstract |
|---|---|---|
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No abstract available |
| 40748658 | Exosomes released from senescent cells and circulatory exosomes isolated from human plasma reveal aging-associated proteomic and lipid signatures. | No abstract available |
| 41216884 | Extracellular Vesicles From Multiple Sclerosis White Matter Exhibit Synaptic, Mitochondrial, Complement and Ageing-Related Pathway Dysregulation. | No abstract available |