Protein detail
RHG24
Rho GTPase-activating protein 24 (Filamin-A-associated RhoGAP) (FilGAP) (RAC1- and CDC42-specific GTPase-activating protein of 72 kDa) (RC-GAP72) (Rho-type GTPase-activating protein 24) (RhoGAP of 73 kDa) (Sarcoma antigen NY-SAR-88) (p73RhoGAP)
Entry name RHG24 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Rho GTPase-activating protein 24 (Filamin-A-associated RhoGAP) (FilGAP) (RAC1- and CDC42-specific GTPase-activating protein of 72 kDa) (RC-GAP72) (Rho-type GTPase-activating protein 24) (RhoGAP of 73 kDa) (Sarcoma antigen NY-SAR-88) (p73RhoGAP)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
DKFZP564B1162FilGAPFLJ33877
Gene Description
Rho GTPase activating protein 24
Chromosome
4
Position
85475150-86002668
Supporting publications (n)
1
EVMP confidence score
0.38
Fluorescence & Localization5
Tissue Specificblood vesselCell SpecificFibro-adipogenic progenitorsSingle-Nuclei Brain Specificendothelial cellSecretome LocationSecreted to extracellular matrixSecretome FunctionNo annotated function
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component (5)
Molecular Function (2)
Biological Process (3)
Reactome (5)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence21
Enzyme-Mediated Modification (11)
11 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ARHGAP24 | ROCK1 | Q13464 | S | 574 | phosphorylation | MIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | T | 576 | phosphorylation | MIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | S | 415 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | T | 577 | phosphorylation | MIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | S | 437 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | S | 413 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | S | 402 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | S | 573 | phosphorylation | MIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | T | 575 | phosphorylation | MIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | T | 452 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
Page 1 of 2Next
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ROCK1 | Q13464 | RHG24 | Q8N264 | Yes | Yes | No | AdhesomeMIMPPhosphoSite_MIMPHPRD_MIMPPhosphoSite_norefSIGNORiPTMnetProtMapperHPRDKEAHPRD_KEASIGNOR_ProtMapperPhosphoSiteHPRD-phosPhosphoSite_ProtMapper | Adhesome:16862148HPRD:16862148HPRD-phos:16862148PhosphoSite:16862148PhosphoSite:26359494ProtMapper:16862148KEA:16862148SIGNOR:16862148 |
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ARHGAP24DKK1RBM45TK2WBP4 | O00142O75554O94907Q8IUH3Q8N264 | 0:0:0:0:0 | hu.MAP2 | |||
| ARHGAP24CTNNBIP1DKK1GSTK1RBM45TK2WBP4 | O00142O75554O94907Q8IUH3Q8N264Q9NSA3Q9Y2Q3 | 0:0:0:0:0:0:0 | hu.MAP2 | |||
| ARHGAP24CTNNBIP1DKK1GSTK1RBM45TK2 | O00142O94907Q8IUH3Q8N264Q9NSA3Q9Y2Q3 | 0:0:0:0:0:0 | hu.MAP2 | |||
| ARHGAP24CTNNBIP1DKK1GSTK1TK2 | O00142O94907Q8N264Q9NSA3Q9Y2Q3 | 0:0:0:0:0 | hu.MAP2 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Polymer Precipitation | Western blotting | 1 | 38731868 |
Sequence, Structure & Domains10
Sequences
Length
748
Mass
84,258
Sequence
MEENNDSTENPQQGQGRQNAIKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTIFLPGNKVSEHPCNEENPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQDGVSNNNEIQKKATMGQLQNKENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMVKKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNGTVRMGILNSDTLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDDLSHPRDYESKSDHRSVGGRSSRATSSSDNSETFVGNSSSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRTERGNTIWIQ
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=Q8N264-1; Sequence=Displayed; Name=2; IsoId=Q8N264-2; Sequence=VSP_023712, VSP_023715; Name=3; IsoId=Q8N264-3; Sequence=VSP_023711; Name=4; IsoId=Q8N264-4; Sequence=VSP_023717, VSP_023718; Name=5; IsoId=Q8N264-5; Sequence=VSP_023713, VSP_023714, VSP_023716
Alternative Sequence
1..95; Missing (in isoform 3); 1..93; Missing (in isoform 2); 1; M -> MWLRKKDWQIFNEQFLKKEHAVGFCFSKCVLVEFSLKCFKKIKSSYWNNDALAFLGKKFLREKNKMTKKQTRNRQNKFPPKPALRSSPVHRVQHFPLLWKVKEPHYHLFFFAFSYCWSWEPFPSEQQPCPASVLSSQQGKSISLIM (in isoform 5); 91..94; GDRD -> KIFS (in isoform 5); 94..130; DRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGG -> MPEDRNSGGCPAGALASTPFIPKTTYRRIKRCFSFRK (in isoform 2); 95..748; Missing (in isoform 5); 245..246; GV -> VS (in isoform 4); 247..748; Missing (in isoform 4)
Domain & Motif Annotations
Compositional Bias
7..18; Polar residues; 356..374; Polar residues; 382..405; Polar residues; 432..476; Polar residues; 600..615; Basic and acidic residues; 617..641; Low complexity
Coiled Coil
649..729
Domain (CC)
The coiled coil domain mediates the interaction with FLNA leading to its recruitment to lamellae.
Domain (FT)
19..125; PH; 135..329; Rho-GAP
Region
1..20; Disordered; 354..476; Disordered; 582..641; Disordered
Clinical Relevance1
Antibody
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 34265469 | Proteomic Landscape of Exosomes Reveals the Functional Contributions of CD151 in Triple-Negative Breast Cancer. | Furthermore, utilizing quantitative proteomics approach to reveal the proteomes of CD151-deleted exosomes and cells, we found that exosomal CD151 facilitated secretion of ribosomal proteins via exosomes while inhibiting exosome secretion of complement proteins. Moreover, we proved that CD151-deleted exosomes significantly decreased the migration and invasion of TNBC cells. Most importantly, we found that the tetraspanin CD151 expression levels in TNBC-derived serum exosomes were significantly higher than those exosomes from healthy subjects, and we validated our findings with samples from 16 additional donors. This is the first comparative study of the proteomes of TNBC patient-derived and CD151-deleted exosomes. |