Protein detail
RHG24
Rho GTPase-activating protein 24 (Filamin-A-associated RhoGAP) (FilGAP) (RAC1- and CDC42-specific GTPase-activating protein of 72 kDa) (RC-GAP72) (Rho-type GTPase-activating protein 24) (RhoGAP of 73 kDa) (Sarcoma antigen NY-SAR-88) (p73RhoGAP)
Protein symbol RHG24 | UniProt ID | EVMP score 0.38 |
Frequency 1 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Rho GTPase-activating protein 24 (Filamin-A-associated RhoGAP) (FilGAP) (RAC1- and CDC42-specific GTPase-activating protein of 72 kDa) (RC-GAP72) (Rho-type GTPase-activating protein 24) (RhoGAP of 73 kDa) (Sarcoma antigen NY-SAR-88) (p73RhoGAP)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
DKFZP564B1162FilGAPFLJ33877
Gene Description
Rho GTPase activating protein 24
Chromosome
4
Position
85475150-86002668
Frequency
1
EVMP Score
0.38
Fluorescence & Localization
Tissue Specificblood vesselCell SpecificFibro-adipogenic progenitorsSingle-Nuclei Brain Specificendothelial cellSecretome LocationSecreted to extracellular matrixSecretome FunctionNo annotated function
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component
Molecular Function
Biological Process
Reactome
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
11 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ARHGAP24 | ROCK1 | Q13464 | S | 574 | phosphorylation | MIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | T | 576 | phosphorylation | MIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | S | 415 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | T | 577 | phosphorylation | MIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | S | 437 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | S | 413 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | S | 402 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | S | 573 | phosphorylation | MIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | T | 575 | phosphorylation | MIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
| ARHGAP24 | ROCK1 | Q13464 | T | 452 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:16862148HPRD:16862148SIGNOR:16862148KEA:16862148 |
Page 1 of 2Next
Ligand-Receptor Signaling
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ROCK1 | Q13464 | RHG24 | Q8N264 | Yes | Yes | No | AdhesomeMIMPPhosphoSite_MIMPHPRD_MIMPPhosphoSite_norefSIGNORiPTMnetProtMapperHPRDKEAHPRD_KEASIGNOR_ProtMapperPhosphoSiteHPRD-phosPhosphoSite_ProtMapper | Adhesome:16862148HPRD:16862148HPRD-phos:16862148PhosphoSite:16862148PhosphoSite:26359494ProtMapper:16862148KEA:16862148SIGNOR:16862148 |
Protein Complex Composition
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ARHGAP24DKK1RBM45TK2WBP4 | O00142O75554O94907Q8IUH3Q8N264 | 0:0:0:0:0 | hu.MAP2 | |||
| ARHGAP24CTNNBIP1DKK1GSTK1RBM45TK2WBP4 | O00142O75554O94907Q8IUH3Q8N264Q9NSA3Q9Y2Q3 | 0:0:0:0:0:0:0 | hu.MAP2 | |||
| ARHGAP24CTNNBIP1DKK1GSTK1RBM45TK2 | O00142O94907Q8IUH3Q8N264Q9NSA3Q9Y2Q3 | 0:0:0:0:0:0 | hu.MAP2 | |||
| ARHGAP24CTNNBIP1DKK1GSTK1TK2 | O00142O94907Q8N264Q9NSA3Q9Y2Q3 | 0:0:0:0:0 | hu.MAP2 |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Polymer Precipitation | Western blotting | 1 | 38731868 |
Sequence, Structure & Domains
Sequences
Length
748
Mass
84,258
Sequence
MEENNDSTENPQQGQGRQNAIKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTIFLPGNKVSEHPCNEENPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQDGVSNNNEIQKKATMGQLQNKENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMVKKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNGTVRMGILNSDTLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDDLSHPRDYESKSDHRSVGGRSSRATSSSDNSETFVGNSSSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRTERGNTIWIQ
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=Q8N264-1; Sequence=Displayed; Name=2; IsoId=Q8N264-2; Sequence=VSP_023712, VSP_023715; Name=3; IsoId=Q8N264-3; Sequence=VSP_023711; Name=4; IsoId=Q8N264-4; Sequence=VSP_023717, VSP_023718; Name=5; IsoId=Q8N264-5; Sequence=VSP_023713, VSP_023714, VSP_023716
Alternative Sequence
1..95; Missing (in isoform 3); 1..93; Missing (in isoform 2); 1; M -> MWLRKKDWQIFNEQFLKKEHAVGFCFSKCVLVEFSLKCFKKIKSSYWNNDALAFLGKKFLREKNKMTKKQTRNRQNKFPPKPALRSSPVHRVQHFPLLWKVKEPHYHLFFFAFSYCWSWEPFPSEQQPCPASVLSSQQGKSISLIM (in isoform 5); 91..94; GDRD -> KIFS (in isoform 5); 94..130; DRMTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGG -> MPEDRNSGGCPAGALASTPFIPKTTYRRIKRCFSFRK (in isoform 2); 95..748; Missing (in isoform 5); 245..246; GV -> VS (in isoform 4); 247..748; Missing (in isoform 4)
3D Structural Models
Domain & Motif Annotations
Compositional Bias
7..18; Polar residues; 356..374; Polar residues; 382..405; Polar residues; 432..476; Polar residues; 600..615; Basic and acidic residues; 617..641; Low complexity
Coiled Coil
649..729
Domain (CC)
The coiled coil domain mediates the interaction with FLNA leading to its recruitment to lamellae.
Domain (FT)
19..125; PH; 135..329; Rho-GAP
Region
1..20; Disordered; 354..476; Disordered; 582..641; Disordered
Clinical Relevance
Antibody