Protein detail

LYPD1

Ly6/PLAUR domain-containing protein 1 (Putative HeLa tumor suppressor) (PHTS)

Entry name LYPD1	UniProt ID Q8N2G4	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information6

Protein Names

Ly6/PLAUR domain-containing protein 1 (Putative HeLa tumor suppressor) (PHTS)

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000150551

Entrez Gene Symbol

LYPD1

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization2

Cell SpecificCytotrophoblasts

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (4)

Molecular Function (3)

Biological Process (3)

Reactome (2)

Mediation Categories (2)

Metabolism mediationReceptor-signaling mediation

Relations & Evidence14

Ligand-Receptor Signaling (12)

12 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
extracellular	extracellular	OmniPath	No	No	No	No	No
ly6_plaur	receptor_regulator	OmniPath	Yes	No	No	No	No
receptor_regulator	receptor_regulator	OmniPath	Yes	No	No	No	No
transmembrane_predicted	transmembrane	OmniPath	No	No	No	No	No
transmembrane	transmembrane	GO_Intercell	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	No	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	No	No
cell_surface	cell_surface	Surfaceome	No	No	No	No	No
cell_surface	cell_surface	OmniPath	No	No	No	No	No

Page 1 of 2Next

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	LYPD1 SPINK7	P58062 Q8N2G4	0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Western blotting	2	39408670 40596376

Sequence, Structure & Domains9

Sequences

Length

141

Mass

15,240

Sequence

MWVLGIAATFCGLFLLPGFALQIQCYQCEEFQLNNDCSSPEFIVNCTVNVQDMCQKEVMEQSAGIMYRKSCASSAACLIASAGYQSFCSPGKLNSVCISCCNTPLCNGPRPKKRGSSASALRPGLRTTILFLKLALFSAHC

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q8N2G4-1; Sequence=Displayed; Name=2; IsoId=Q8N2G4-2; Sequence=VSP_021584; Name=3; IsoId=Q8N2G4-3; Sequence=VSP_021583; Name=4; IsoId=Q8N2G4-4; Sequence=VSP_046981

Alternative Sequence

1..52; Missing (in isoform 4); 1..5; MWVLG -> MQAPRAAPAAPLSYDRRLRGS (in isoform 3); 1; M -> MQAPRAAPAAPLSYDRRPRDSGRM (in isoform 2)

3D Structural Models

Helix

74..82

Beta Strand

33..35; 42..44; 48..60; 65..73; 97..103

3D Structure

NMR spectroscopy (1)

Domain & Motif Annotations

Domain (FT)

25..107; UPAR/Ly6

Supporting Publications1

PMID	Title	Abstract
27470641	Phosphoproteome Characterization of Human Colorectal Cancer SW620 Cell-Derived Exosomes and New Phosphosite Discovery for C-HPP.	No abstract available