Protein detail

NGEF

Ephexin-1 (Eph-interacting exchange protein) (Neuronal guanine nucleotide exchange factor)

Protein symbol NGEF	UniProt ID Q8N5V2	EVMP score 0.50
Frequency 2	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Ephexin-1 (Eph-interacting exchange protein) (Neuronal guanine nucleotide exchange factor)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000066248

Entrez Gene Symbol

NGEF

Gene Synonym

ARHGEF27

Gene Description

Neuronal guanine nucleotide exchange factor

Chromosome

Position

232878701-233013256

Frequency

EVMP Score

0.50

Fluorescence & Localization

Cell SpecificAlveolar cells type 1

Function & Pathway

Protein Function

Predicted intracellular proteins

Cellular Component

Molecular Function

Biological Process

KEGG

hsa04360 Axon guidance

Reactome

Mediation Categories

Receptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

9 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
NGEF	BLK	P51451	Y	179	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:15848799 ProtMapper:11336673
NGEF	FYN	P06241	Y	179	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:15848799 ProtMapper:11336673
NGEF	LCK	P06239	Y	179	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:15848799 ProtMapper:11336673
NGEF	SRC	P12931	Y	179	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:15848799 ProtMapper:11336673
NGEF	LYN	P07948	Y	179	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:15848799 ProtMapper:11336673
NGEF	YES1	P07947	Y	179	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:15848799 ProtMapper:11336673
NGEF	HCK	P08631	Y	179	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:15848799 ProtMapper:11336673
NGEF	FGR	P09769	Y	179	phosphorylation	NCI-PID_ProtMapperProtMapper	ProtMapper:15848799 ProtMapper:11336673
NGEF	CDK5	Q00535	T	41	phosphorylation	REACH_ProtMapperProtMapper	ProtMapper:20543890

Ligand-Receptor Signaling

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
EPHA4	P54764	NGEF	Q8N5V2	Yes	Yes	No	PhosphoPointHPRDSignaLink3WangSPIKE_LC	SignaLink3:23331499 HPRD:11336673 SignaLink3:11336673 SignaLink3:21071413 SPIKE_LC:16189514
CDK5	Q00535	NGEF	Q8N5V2	Yes	Yes	No	REACH_ProtMapperSIGNORProtMapper	ProtMapper:20543890 SIGNOR:28769056
NGEF	Q8N5V2	RHOA	P61586	Yes	Yes	No	SIGNORHINTACSNWangSPIKE_LC	ACSN:9113980 ACSN:9789025 SIGNOR:32203420 HINT:32203420 SPIKE_LC:18256687 ACSN:11149925 ACSN:9641915 HINT:18256687

Protein Complex Composition

4 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
NGEF PRKCD SLC12A8	A0AV02 Q05655 Q8N5V2	0:0:0	hu.MAP2
FXR1 NGEF PRKCD	P51114 Q05655 Q8N5V2	0:0:0	hu.MAP2
NGEF NUP107 NUP133 NUP98 RGL1 SEC13 SMARCC2	P52948 P55735 P57740 Q8N5V2 Q8TAQ2 Q8WUM0 Q9NZL6	1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9157
NGEF PRKCD	Q05655 Q8N5V2	0:0	hu.MAP2

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	39409015 27894104

Sequence, Structure & Domains

Sequences

Length

710

Mass

82,496

Sequence

METRESEDLEKTRRKSASDQWNTDNEPAKVKPELLPEKEETSQADQDIQDKEPHCHIPIKRNSIFNRSIRRKSKAKARDNPERNASCLADSQDNGKSVNEPLTLNIPWSRMPPCRTAMQTDPGAQEMSESSSTPGNGATPEEWPALADSPTTLTEALRMIHPIPADSWRNLIEQIGLLYQEYRDKSTLQEIETRRQQDAEIEDNTNGSPASEDTPEEEEEEEEEEEPASPPERKTLPQICLLSNPHSRFNLWQDLPEIRSSGVLEILQPEEIKLQEAMFELVTSEASYYKSLNLLVSHFMENERIRKILHPSEAHILFSNVLDVLAVSERFLLELEHRMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPFSSFLILPFQRITRLKLLVQNILKRVEERSERECTALDAHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFHEIYLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQGQTLANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNRRTKFVSFTSRLLDCPQVQCVHPYVAQQPDELTLELADILNILDKTDDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKDRRKLGSRNRQ

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8N5V2-1; Sequence=Displayed; Name=2; IsoId=Q8N5V2-2; Sequence=VSP_020259, VSP_020260, VSP_020261; Name=3; IsoId=Q8N5V2-3; Sequence=VSP_020259, VSP_020260

Alternative Sequence

1..92; Missing (in isoform 2 and isoform 3); 93..127; DNGKSVNEPLTLNIPWSRMPPCRTAMQTDPGAQEM -> MELLAAAFSAACAVDHDSSTSESDARDSAAGHLPG (in isoform 2 and isoform 3); 331..710; Missing (in isoform 2)

3D Structural Models

Domain & Motif Annotations

Compositional Bias

1..11; Basic and acidic residues; 26..41; Basic and acidic residues; 89..102; Polar residues; 127..136; Polar residues; 213..227; Acidic residues; 687..699; Basic and acidic residues; 700..710; Basic residues

Domain (CC)

The DH domain and the PH domain are both required to mediate interaction with EPHA4..

Domain (FT)

273..457; DH; 489..601; PH; 612..673; SH3

Region

1..273; Regulatory region; modulates activity toward RHOA, RAC1 and CDC42; 1..143; Disordered; 194..236; Disordered; 687..710; Disordered

Clinical Relevance

Antibody

HPA008160