Protein detail
NGEF
Ephexin-1 (Eph-interacting exchange protein) (Neuronal guanine nucleotide exchange factor)
Entry name NGEF | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Ephexin-1 (Eph-interacting exchange protein) (Neuronal guanine nucleotide exchange factor)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
ARHGEF27
Gene Description
Neuronal guanine nucleotide exchange factor
Chromosome
2
Position
232878701-233013256
Supporting publications (n)
2
EVMP confidence score
0.50
Fluorescence & Localization2
Cell SpecificAlveolar cells type 1
Function & Pathway7
Protein Function
Predicted intracellular proteins
Cellular Component (3)
Molecular Function (2)
Biological Process (3)
Reactome (14)
- R-hsa-9013148 cdc42 gtpase cycle
- R-hsa-204998 cell death signalling via nrage nrif and nade
- R-hsa-73887 death receptor signaling
- R-hsa-3928663 epha mediated growth cone collapse
- R-hsa-2682334 eph ephrin signaling
- R-hsa-416482 g alpha 12 13 signalling events
- R-hsa-9675108 nervous system development
- R-hsa-193648 nrage signals death through jnk
- R-hsa-193704 p75 ntr receptor mediated signalling
- R-hsa-9013149 rac1 gtpase cycle
Page 1 of 2
Mediation Categories
Receptor-signaling mediation
Relations & Evidence21
Enzyme-Mediated Modification (9)
9 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| NGEF | BLK | P51451 | Y | 179 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:15848799ProtMapper:11336673 |
| NGEF | FYN | P06241 | Y | 179 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:15848799ProtMapper:11336673 |
| NGEF | LCK | P06239 | Y | 179 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:15848799ProtMapper:11336673 |
| NGEF | SRC | P12931 | Y | 179 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:15848799ProtMapper:11336673 |
| NGEF | LYN | P07948 | Y | 179 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:15848799ProtMapper:11336673 |
| NGEF | YES1 | P07947 | Y | 179 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:15848799ProtMapper:11336673 |
| NGEF | HCK | P08631 | Y | 179 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:15848799ProtMapper:11336673 |
| NGEF | FGR | P09769 | Y | 179 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:15848799ProtMapper:11336673 |
| NGEF | CDK5 | Q00535 | T | 41 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:20543890 |
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| EPHA4 | P54764 | NGEF | Q8N5V2 | Yes | Yes | No | PhosphoPointHPRDSignaLink3WangSPIKE_LC | SignaLink3:23331499HPRD:11336673SignaLink3:11336673SignaLink3:21071413SPIKE_LC:16189514 |
| CDK5 | Q00535 | NGEF | Q8N5V2 | Yes | Yes | No | REACH_ProtMapperSIGNORProtMapper | ProtMapper:20543890SIGNOR:28769056 |
| NGEF | Q8N5V2 | RHOA | P61586 | Yes | Yes | No | SIGNORHINTACSNWangSPIKE_LC | ACSN:9113980ACSN:9789025SIGNOR:32203420HINT:32203420SPIKE_LC:18256687ACSN:11149925ACSN:9641915HINT:18256687 |
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| NGEFPRKCDSLC12A8 | A0AV02Q05655Q8N5V2 | 0:0:0 | hu.MAP2 | |||
| FXR1NGEFPRKCD | P51114Q05655Q8N5V2 | 0:0:0 | hu.MAP2 | |||
| NGEFNUP107NUP133NUP98RGL1SEC13SMARCC2 | P52948P55735P57740Q8N5V2Q8TAQ2Q8WUM0Q9NZL6 | 1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC9157 | ||
| NGEFPRKCD | Q05655Q8N5V2 | 0:0 | hu.MAP2 |
Sequence, Structure & Domains9
Sequences
Length
710
Mass
82,496
Sequence
METRESEDLEKTRRKSASDQWNTDNEPAKVKPELLPEKEETSQADQDIQDKEPHCHIPIKRNSIFNRSIRRKSKAKARDNPERNASCLADSQDNGKSVNEPLTLNIPWSRMPPCRTAMQTDPGAQEMSESSSTPGNGATPEEWPALADSPTTLTEALRMIHPIPADSWRNLIEQIGLLYQEYRDKSTLQEIETRRQQDAEIEDNTNGSPASEDTPEEEEEEEEEEEPASPPERKTLPQICLLSNPHSRFNLWQDLPEIRSSGVLEILQPEEIKLQEAMFELVTSEASYYKSLNLLVSHFMENERIRKILHPSEAHILFSNVLDVLAVSERFLLELEHRMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPFSSFLILPFQRITRLKLLVQNILKRVEERSERECTALDAHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFHEIYLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQGQTLANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNRRTKFVSFTSRLLDCPQVQCVHPYVAQQPDELTLELADILNILDKTDDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKDRRKLGSRNRQ
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8N5V2-1; Sequence=Displayed; Name=2; IsoId=Q8N5V2-2; Sequence=VSP_020259, VSP_020260, VSP_020261; Name=3; IsoId=Q8N5V2-3; Sequence=VSP_020259, VSP_020260
Alternative Sequence
1..92; Missing (in isoform 2 and isoform 3); 93..127; DNGKSVNEPLTLNIPWSRMPPCRTAMQTDPGAQEM -> MELLAAAFSAACAVDHDSSTSESDARDSAAGHLPG (in isoform 2 and isoform 3); 331..710; Missing (in isoform 2)
Domain & Motif Annotations
Compositional Bias
1..11; Basic and acidic residues; 26..41; Basic and acidic residues; 89..102; Polar residues; 127..136; Polar residues; 213..227; Acidic residues; 687..699; Basic and acidic residues; 700..710; Basic residues
Domain (CC)
The DH domain and the PH domain are both required to mediate interaction with EPHA4..
Domain (FT)
273..457; DH; 489..601; PH; 612..673; SH3
Region
1..273; Regulatory region; modulates activity toward RHOA, RAC1 and CDC42; 1..143; Disordered; 194..236; Disordered; 687..710; Disordered
Clinical Relevance1
Antibody
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 36507906 | Proteomics Analysis of Plasma-Derived Exosomes Unveils the Aberrant Complement and Coagulation Cascades in Dermatomyositis/Polymyositis. | No abstract available |
| 39535266 | Divergent Proteomic Profiles and Uptake Mechanisms of Exosomes Derived from Human Dental Pulp Stem Cells, Endothelial Cells, and Fibroblasts. | No abstract available |