Protein detail
OR2C3
Olfactory receptor 2C3 (Olfactory receptor 2C4) (Olfactory receptor 2C5) (Olfactory receptor OR1-30)
Entry name OR2C3 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 7 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Olfactory receptor 2C3 (Olfactory receptor 2C4) (Olfactory receptor 2C5) (Olfactory receptor OR1-30)
Protein Function
G-protein coupled receptors:Odorant/olfactory and gustatory receptors
Transmembrane
27..50; Helical; Name=1; 59..80; Helical; Name=2; 102..121; Helical; Name=3; 141..159; Helical; Name=4; 197..220; Helical; Name=5; 238..260; Helical; Name=6; 274..293; Helical; Name=7
Transmembrane Count
7
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization4
Tissue SpecificcervixCell SpecificBergmann gliaSingle-Nuclei Brain Specificcommitted oligodendrocyte precursor
Function & Pathway7
Protein Function
G-protein coupled receptors:Odorant/olfactory and gustatory receptors
Cellular Component
Molecular Function (2)
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence33
Ligand-Receptor Signaling (32)
32 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | HPMR | No | Yes | No | Yes | No |
| receptor | receptor | Surfaceome | No | Yes | No | Yes | No |
| gpcr | receptor | DGIdb | No | Yes | No | Yes | No |
| gpcr | receptor | UniProt_keyword | No | Yes | No | Yes | No |
| seven_transmembrane_7tm | receptor | HPMR | No | Yes | No | Yes | No |
| 7tm_d | receptor | HPMR | No | Yes | No | Yes | No |
| 7tm_d_olfactory_7tm_d | receptor | HPMR | No | Yes | No | Yes | No |
| gpcr | receptor | Surfaceome | No | Yes | No | Yes | No |
| olf | receptor | Surfaceome | No | Yes | No | Yes | No |
| class_o2_tetrapod_specific_odorant | receptor | GPCRdb | No | Yes | No | Yes | No |
Page 1 of 4Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometrySmall R sequencing (Illumi HiSeq 2000 (Solexa) | 24 | 409858793792675636064647381133684046519537322475333044783393657040189497388959624106825333592500380145953447350532560723329169864130796836146834408407013180595838207106345762463720451539207047 |
Sequence, Structure & Domains5
Sequences
Length
320
Mass
35,376
Sequence
MMEIANVSSPEVFVLLGFSTRPSLETVLFIVVLSFYMVSILGNGIIILVSHTDVHLHTPMYFFLANLPFLDMSFTTSIVPQLLANLWGPQKTISYGGCVVQFYISHWLGATECVLLATMSYDRYAAICRPLHYTVIMHPQLCLGLALASWLGGLTTSMVGSTLTMLLPLCGNNCIDHFFCEMPLIMQLACVDTSLNEMEMYLASFVFVVLPLGLILVSYGHIARAVLKIRSAEGRRKAFNTCSSHVAVVSLFYGSIIFMYLQPAKSTSHEQGKFIALFYTVVTPALNPLIYTLRNTEVKSALRHMVLENCCGSAGKLAQI
Domain & Motif Annotations
Protein Families
G-protein coupled receptor 1 family
Sequence Similarities
Belongs to the G-protein coupled receptor 1 family.
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 30550287 | Label-Free Proteomic Analysis of Exosomes Secreted from THP-1-Derived Macrophages Treated with IFN-α Identifies Antiviral Proteins Enriched in Exosomes. | No abstract available |