Protein detail
ENAH
Protein enabled homolog
Protein symbol ENAH | UniProt ID | EVMP score 0.38 |
Frequency 1 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Protein enabled homolog
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
FLJ10773MENANDPP1
Gene Description
ENAH actin regulator
Chromosome
1
Position
225486765-225653142
Frequency
1
EVMP Score
0.38
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificB-cellsSingle-Nuclei Brain Specificleukocyte
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component
Molecular Function
KEGG
Reactome
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| actin_regulation_adhesome | intracellular_intercellular_related | Adhesome | Yes | No | No | No | No |
| intracellular_intercellular_related | intracellular_intercellular_related | OmniPath | Yes | No | No | No | No |
Regulatory Interaction Network
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KGP1 | Q13976 | ENAH | Q8N8S7 | Yes | No | Yes | SIGNOR | SIGNOR:15066263 |
| RAPH1 | Q70E73 | ENAH | Q8N8S7 | Yes | Yes | No | SIGNOR | SIGNOR:20417104 |
| BAIP2 | Q9UQB8 | ENAH | Q8N8S7 | Yes | Yes | No | HPRDWangSIGNOR | SIGNOR:11696321HPRD:11696321 |
Protein Complex Composition
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ARCCBX5ENAHGLOD4GOT1HPF1NUP42PPIL3RAE1RBM4BRPS21SUPT3HTXNWDR82 | O15504O75486P10599P17174P45973P63220P78406Q6UXN9Q7LC44Q8N8S7Q9BQ04Q9H2H8Q9HC38Q9NWY4 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC9762 | ||
| ENAHPTPN1 | P18031Q8N8S7 | 1:1 | PDB | PDB:9c66 | ||
| ENAH | Q8N8S7 | 2 | PDB | PDB:5n91PDB:5nd0PDB:5nduPDB:5ncfPDB:6xxrPDB:4my6PDB:5negPDB:6rd2PDB:5najPDB:5n9pPDB:5n9cPDB:5ncgPDB:6xvtPDB:5nbx | ||
| ENAHTES | Q8N8S7Q9UGI8 | 4:4 | PDB | PDB:2iyb | ||
| ACTL7AENAHTES | Q8N8S7Q9UGI8Q9Y615 | 1:1:1 | PDB | PDB:2xqn |
Isolation & Detection Technology
0 records.
Sequence, Structure & Domains
Sequences
Length
591
Mass
66,510
Sequence
MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETGPTLPRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERLERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSVLGDSSASEPGLQAASQPAETPSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIGVNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTPEPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8N8S7-1; Sequence=Displayed; Name=2; IsoId=Q8N8S7-2; Sequence=VSP_010564; Name=3; Synonyms=Deltav6; IsoId=Q8N8S7-3; Sequence=VSP_053772, VSP_053773
Alternative Sequence
268..304; Missing (in isoform 3); 513..533; Missing (in isoform 3); 514..534; Missing (in isoform 2)
3D Structural Models
Turn
18..21; 41..44; 53..55
Helix
26..28; 94..110
Beta Strand
3..17; 22..25; 32..40; 45..52; 58..64; 70..72; 74..81; 82..85; 86..93
3D Structure
X-ray crystallography (27)
Domain & Motif Annotations
Compositional Bias
115..136; Polar residues; 221..264; Basic and acidic residues; 275..305; Polar residues; 311..323; Pro residues; 330..373; Pro residues; 432..443; Gly residues; 479..491; Polar residues; 499..509; Polar residues; 538..549; Polar residues
Repeat
156..160; 1; 161..165; 2; 166..170; 3; 171..175; 4; 176..180; 5; 181..185; 6; 186..190; 7; 191..195; 8; 196..200; 9
Motif
400..403; KLKR
Coiled Coil
135..265; 557..587
Domain (CC)
The EVH2 domain is comprised of 3 regions. Block A is a thymosin-like domain required for G-actin binding. The KLKR motif within this block is essential for the G-actin binding and for actin polymerization. Block B is required for F-actin binding and subcellular location, and Block C for tetramerization.
Domain (FT)
1..111; WH1
Region
115..146; Disordered; 156..200; 9 X 5 AA tandem repeats of [LMQ]-E-[QR]-E-[QR]; 221..379; Disordered; 391..588; EVH2; 391..411; EVH2 block A; 405..549; Disordered; 442..459; EVH2 block B; 554..588; EVH2 block C
Protein Families
Ena/VASP family
Sequence Similarities
Belongs to the Ena/VASP family.