Protein detail
ENAH
Protein enabled homolog
Entry name ENAH | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Predicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Protein enabled homolog
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
FLJ10773MENANDPP1
Gene Description
ENAH actin regulator
Chromosome
1
Position
225486765-225653142
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificB-cellsSingle-Nuclei Brain Specificleukocyte
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (9)
Molecular Function (4)
KEGG (4)
Reactome (5)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence15
Ligand-Receptor Signaling (7)
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| actin_regulation_adhesome | intracellular_intercellular_related | Adhesome | Yes | ||||
| intracellular_intercellular_related | intracellular_intercellular_related | OmniPath | Yes |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KGP1 | Q13976 | ENAH | Q8N8S7 | Yes | Yes | SIGNOR | SIGNOR:15066263 | |
| RAPH1 | Q70E73 | ENAH | Q8N8S7 | Yes | Yes | SIGNOR | SIGNOR:20417104 | |
| BAIP2 | Q9UQB8 | ENAH | Q8N8S7 | Yes | Yes | HPRDWangSIGNOR | SIGNOR:11696321HPRD:11696321 |
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ARCCBX5ENAHGLOD4GOT1HPF1NUP42PPIL3RAE1RBM4BRPS21SUPT3HTXNWDR82 | O15504O75486P10599P17174P45973P63220P78406Q6UXN9Q7LC44Q8N8S7Q9BQ04Q9H2H8Q9HC38Q9NWY4 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC9762 | ||
| ENAHPTPN1 | P18031Q8N8S7 | 1:1 | PDB | PDB:9c66 | ||
| ENAH | Q8N8S7 | 2 | PDB | PDB:5n91PDB:5nd0PDB:5nduPDB:5ncfPDB:6xxrPDB:4my6PDB:5negPDB:6rd2PDB:5najPDB:5n9pPDB:5n9cPDB:5ncgPDB:6xvtPDB:5nbx | ||
| ENAHTES | Q8N8S7Q9UGI8 | 4:4 | PDB | PDB:2iyb | ||
| ACTL7AENAHTES | Q8N8S7Q9UGI8Q9Y615 | 1:1:1 | PDB | PDB:2xqn |
Sequence, Structure & Domains
Sequences
Length
591
Mass
66,510
Sequence
MSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGNNTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASAMMHALEVLNSQETGPTLPRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERLERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSVLGDSSASEPGLQAASQPAETPSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIGVNSASSKTDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTPEPTRKPWERTNTMNGSKSPVISRRDSPRKNQIVFDNRSYDSLHRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8N8S7-1; Sequence=Displayed; Name=2; IsoId=Q8N8S7-2; Sequence=VSP_010564; Name=3; Synonyms=Deltav6; IsoId=Q8N8S7-3; Sequence=VSP_053772, VSP_053773
Alternative Sequence
268..304; Missing (in isoform 3); 513..533; Missing (in isoform 3); 514..534; Missing (in isoform 2)
3D Structural Models
Turn
18..21; 41..44; 53..55
Helix
26..28; 94..110
Beta Strand
3..17; 22..25; 32..40; 45..52; 58..64; 70..72; 74..81; 82..85; 86..93
3D Structure
X-ray crystallography (27)
Domain & Motif Annotations
Compositional Bias
115..136; Polar residues; 221..264; Basic and acidic residues; 275..305; Polar residues; 311..323; Pro residues; 330..373; Pro residues; 432..443; Gly residues; 479..491; Polar residues; 499..509; Polar residues; 538..549; Polar residues
Repeat
156..160; 1; 161..165; 2; 166..170; 3; 171..175; 4; 176..180; 5; 181..185; 6; 186..190; 7; 191..195; 8; 196..200; 9
Motif
400..403; KLKR
Coiled Coil
135..265; 557..587
Domain (CC)
The EVH2 domain is comprised of 3 regions. Block A is a thymosin-like domain required for G-actin binding. The KLKR motif within this block is essential for the G-actin binding and for actin polymerization. Block B is required for F-actin binding and subcellular location, and Block C for tetramerization.
Domain (FT)
1..111; WH1
Region
115..146; Disordered; 156..200; 9 X 5 AA tandem repeats of [LMQ]-E-[QR]-E-[QR]; 221..379; Disordered; 391..588; EVH2; 391..411; EVH2 block A; 405..549; Disordered; 442..459; EVH2 block B; 554..588; EVH2 block C
Protein Families
Ena/VASP family
Sequence Similarities
Belongs to the Ena/VASP family.
Clinical Relevance
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 27487081 | Comparative Proteomic Analysis of Extracellular Vesicles Isolated by Acoustic Trapping or Differential Centrifugation. | No related sentences available |