Protein detail
ADCY4
Adenylate cyclase type 4 (EC 4.6.1.1) (ATP pyrophosphate-lyase 4) (Adenylate cyclase type IV) (Adenylyl cyclase 4)
Entry name ADCY4 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 12 | Protein classification EnzymesMetabolic proteinsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Adenylate cyclase type 4 (EC 4.6.1.1) (ATP pyrophosphate-lyase 4) (Adenylate cyclase type IV) (Adenylyl cyclase 4)
Protein Class (5)
EnzymesMetabolic proteinsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (3)
- Enzymes
- Predicted intracellular proteins
- ENZYME proteins:Lyases
Transmembrane
29..50; Helical; 61..80; Helical; 94..117; Helical; 120..138; Helical; 141..162; Helical; 170..190; Helical; 586..607; Helical; 611..633; Helical; 664..687; Helical; 715..736; Helical; 744..764; Helical; 791..807; Helical
Transmembrane Count
12
Ensembl
Entrez Gene Symbol
Gene Synonym
AC4
Gene Description
Adenylate cyclase 4
Chromosome
14
Position
24318349-24335093
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecificovaryCell SpecificAdipocytesSingle-Nuclei Brain Specificendothelial cellBlood Cell Specificintermediate monocyteBlood Lineage Specificmonocytes
Function & Pathway
Protein Function (3)
- Enzymes
- Predicted intracellular proteins
- ENZYME proteins:Lyases
Cellular Component (4)
Molecular Function (5)
Biological Process (3)
KEGG (52)
- hsa00230 Purine metabolism
- KEGG:hsa01100 Metabolic pathways
- KEGG:hsa01522 Endocrine resistance
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04024 cAMP signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04081 Hormone signaling
Page 1 of 6
Reactome (34)
- R-hsa-170660 adenylate cyclase activating pathway
- R-hsa-170670 adenylate cyclase inhibitory pathway
- R-hsa-9660821 adora2b mediated anti inflammatory cytokines production
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-445717 aquaporin mediated transport
- R-hsa-111996 ca dependent events
- R-hsa-9855142 cellular responses to mechanical stimuli
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-1489509 dag and ip3 signaling
- R-hsa-9664323 fcgr3a mediated il10 synthesis
Page 1 of 4
Canonical Pathways (3)
- M103 Pid s1p s1p1 pathway
- M155 Pid s1p meta pathway
- M55 Pid s1p s1p3 pathway
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence16
Ligand-Receptor Signaling (15)
15 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | ||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| transmembrane | transmembrane | UniProt_location | |||||
| transmembrane | transmembrane | UniProt_topology | |||||
| transmembrane | transmembrane | UniProt_keyword | |||||
| transmembrane | transmembrane | LOCATE | |||||
| transmembrane | transmembrane | Ramilowski_location |
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | NA | 1 | 39535266 |
Sequence, Structure & Domains
Sequences
Length
1,077
Mass
119,794
Sequence
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPSFLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQVSYFLFVIFTAYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVLFLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAGAYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTRYLESWGAAKPFAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFIIQMLVTNRPPALAITYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRPGLRIALGTATILLVFAMAITSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPYSMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGPLDSRPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8NFM4-1; Sequence=Displayed; Name=2; IsoId=Q8NFM4-2; Sequence=VSP_055816, VSP_055817, VSP_055818, VSP_055819
Alternative Sequence
1..45; MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALL -> MSRGTRESACCMLTSWASRGWPASVPLRSWCSCSMSSLASSTRLP (in isoform 2); 46..352; Missing (in isoform 2); 720..726; YSMHCCT -> VSVPTCP (in isoform 2); 727..1077; Missing (in isoform 2)
Domain & Motif Annotations
Domain (CC)
The protein contains two modules with six transmembrane helices each; both are required for catalytic activity. Isolated N-terminal or C-terminal modules have no catalytic activity, but when they are brought together, enzyme activity is restored. The active site is at the interface of the two modules.
Protein Families
Adenylyl cyclase class-4/guanylyl cyclase family
Sequence Similarities
Belongs to the adenylyl cyclase class-4/guanylyl cyclase family.
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No related sentences available |