Protein detail

O13C9

Olfactory receptor 13C9 (Olfactory receptor OR9-13)

Entry name O13C9	UniProt ID Q8NGT0	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count 7	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information8

Protein Names

Olfactory receptor 13C9 (Olfactory receptor OR9-13)

Protein Function

G-protein coupled receptors:Odorant/olfactory and gustatory receptors

Transmembrane

26..46; Helical; Name=1; 55..75; Helical; Name=2; 100..120; Helical; Name=3; 140..160; Helical; Name=4; 198..217; Helical; Name=5; 238..258; Helical; Name=6; 278..298; Helical; Name=7

Transmembrane Count

Ensembl

ENSG00000136839

Entrez Gene Symbol

OR13C9

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization2

Tissue SpecificliverCell SpecificColonocytes

Function & Pathway7

Protein Function

G-protein coupled receptors:Odorant/olfactory and gustatory receptors

Cellular Component (2)

Molecular Function (2)

Biological Process (3)

KEGG

hsa04740 Olfactory transduction

Reactome (2)

Mediation Categories

Other mediation

Relations & Evidence38

Ligand-Receptor Signaling (37)

37 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	HPMR	No	Yes	No	Yes	No
receptor	receptor	Surfaceome	No	Yes	No	Yes	No
gpcr	receptor	DGIdb	No	Yes	No	Yes	No
gpcr	receptor	Almen2009	No	Yes	No	Yes	No
olfactory	receptor	Almen2009	No	Yes	No	Yes	No
gpcr	receptor	UniProt_keyword	No	Yes	No	Yes	No
seven_transmembrane_7tm	receptor	HPMR	No	Yes	No	Yes	No
7tm_d	receptor	HPMR	No	Yes	No	Yes	No
7tm_d_olfactory_7tm_d	receptor	HPMR	No	Yes	No	Yes	No
gpcr	receptor	Surfaceome	No	Yes	No	Yes	No

Page 1 of 4Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry	9	40985879 38113368 40189497 31382537 37563857 30915084 32560723 31805958 38207106

Sequence, Structure & Domains5

Sequences

Length

318

Mass

35,854

Sequence

MEWENQTILVEFFLKGHSVHPRLELLFFVLIFIMYVVILLGNGTLILISILDPHLHTPMYFFLGNLSFLDICYTTTSIPSTLVSFLSERKTISFSGCAVQMFLGLAMGTTECVLLGMMAFDRYVAICNPLRYPIIMSKNAYVPMAVGSWFAGIVNSAVQTTFVVQLPFCRKNVINHFSCEILAVMKLACADISGNEFLMLVATILFTLMPLLLIVISYSLIISSILKIHSSEGRSKAFSTCSAHLTVVIIFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLRNKDVKEAVKHLPNRRFFSK

Domain & Motif Annotations

Protein Families

G-protein coupled receptor 1 family

Sequence Similarities

Belongs to the G-protein coupled receptor 1 family.

Supporting Publications1

PMID	Title	Abstract
37322475	Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration.	No abstract available