Protein detail
IL31R
Interleukin-31 receptor subunit alpha (IL-31 receptor subunit alpha) (IL-31R subunit alpha) (IL-31R-alpha) (IL-31RA) (Cytokine receptor-like 3) (GLM-R) (hGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (ZcytoR17)
Entry name IL31R | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Disease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Interleukin-31 receptor subunit alpha (IL-31 receptor subunit alpha) (IL-31R subunit alpha) (IL-31R-alpha) (IL-31RA) (Cytokine receptor-like 3) (GLM-R) (hGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (ZcytoR17)
Protein Class (4)
Disease related genesHuman disease related genesPredicted intracellular proteinsPredicted membrane proteins
Protein Function (3)
- Disease related genes
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Predicted intracellular proteins
Transmembrane
520..540; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
CRLCRL3GLM-RGlmrIL-31RA
Gene Description
Interleukin 31 receptor A
Chromosome
5
Position
55851357-55922854
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecificintestineCell SpecificColonocytesSecretome LocationSecreted to digestive systemSecretome FunctionNo annotated function
Function & Pathway
Protein Function (3)
- Disease related genes
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Predicted intracellular proteins
Cellular Component (6)
Molecular Function (4)
Biological Process (3)
Reactome (4)
Mediation Categories (2)
Fusion and delivery mediationImmune mediation
Relations & Evidence65
Ligand-Receptor Signaling (58)
58 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cytokine_type_1 | receptor | ICELLNET | Yes | Yes | |||
| receptor | receptor | OmniPath | Yes | Yes | |||
| extracellular | extracellular | HPMR | Yes | ||||
| extracellular | extracellular | DGIdb | Yes | ||||
| extracellular | extracellular | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| transmembrane | transmembrane | UniProt_location | Yes |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| IL31R | Q8NI17 | JAK2 | O60674 | Yes | Yes | SIGNORSignaLink3 | SignaLink3:18926762SignaLink3:23331499SIGNOR:18926762 | |
| IL31 | Q6EBC2 | IL31R | Q8NI17 | Yes | Yes | iTALKSIGNORSignaLink3UniProt_LRdbHPMR_talklrHPMRtalklrscConnectRamilowski2015_Baccin2019WangRamilowski2015HPMR_LRdbBaccin2019EMBRACEGuide2PharmaFantom5_LRdbCellTalkDBconnectomeDB2020LRdb | connectomeDB2020:15184896CellTalkDB:15184896HPMR:15194700Baccin2019:15184896HPMR:15184896SignaLink3:15184896SIGNOR:15184896LRdb:15184896SignaLink3:23331499 | |
| IL31R | Q8NI17 | JAK1 | P23458 | Yes | Yes | SIGNORSignaLink3 | SignaLink3:18926762SignaLink3:23331499SIGNOR:18926762 |
Protein Complex Composition (3)
Sequence, Structure & Domains
Sequences
Length
732
Mass
82,954
Sequence
MMWTWALWMLPSLCKFSLAALPAKPENISCVYYYRKNLTCTWSPGKETSYTQYTVKRTYAFGEKHDNCTTNSSTSENRASCSFFLPRITIPDNYTIEVEAENGDGVIKSHMTYWRLENIAKTEPPKIFRVKPVLGIKRMIQIEWIKPELAPVSSDLKYTLRFRTVNSTSWMEVNFAKNRKDKNQTYNLTGLQPFTEYVIALRCAVKESKFWSDWSQEKMGMTEEEAPCGLELWRVLKPAEADGRRPVRLLWKKARGAPVLEKTLGYNIWYYPESNTNLTETMNTTNQQLELHLGGESFWVSMISYNSLGKSPVATLRIPAIQEKSFQCIEVMQACVAEDQLVVKWQSSALDVNTWMIEWFPDVDSEPTTLSWESVSQATNWTIQQDKLKPFWCYNISVYPMLHDKVGEPYSIQAYAKEGVPSEGPETKVENIGVKTVTITWKEIPKSERKGIICNYTIFYQAEGGKGFSKTVNSSILQYGLESLKRKTSYIVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVAYGLKKPNKLTHLCWPTVPNPAESSIATWHGDDFKDKLNLKESDDSVNTEDRILKPCSTPSDKLVIDKLVVNFGNVLQEIFTDEARTGQENNLGGEKNGYVTCPFRPDCPLGKSFEELPVSPEIPPRKSQYLRSRMPEGTRPEAKEQLLFSGQSLVPDHLCEEGAPNPYLKNSVTAREFLVSEKLPEHTKGEV
Alternative Products
Event=Alternative splicing; Named isoforms=12; Name=1; IsoId=Q8NI17-1; Sequence=Displayed; Name=2; Synonyms=v3; IsoId=Q8NI17-2; Sequence=VSP_022799; Name=3; Synonyms=v4; IsoId=Q8NI17-3; Sequence=VSP_022800, VSP_022812, VSP_022813; Name=4; Synonyms=v2; IsoId=Q8NI17-4; Sequence=VSP_022799, VSP_022801; Name=5; Synonyms=v1; IsoId=Q8NI17-5; Sequence=VSP_022799, VSP_022812, VSP_022813; Name=6; IsoId=Q8NI17-6; Sequence=VSP_022798; Name=7; IsoId=Q8NI17-7; Sequence=VSP_022800, VSP_022802, VSP_022804, VSP_022805; Name=8; IsoId=Q8NI17-8; Sequence=VSP_022799, VSP_022803, VSP_022807; Name=9; Synonyms=GPL560, short; IsoId=Q8NI17-9; Sequence=VSP_022800, VSP_022806; Name=10; Synonyms=GPL610; IsoId=Q8NI17-10; Sequence=VSP_022800, VSP_022809, VSP_022810; Name=11; Synonyms=GPL626; IsoId=Q8NI17-11; Sequence=VSP_022800, VSP_022808, VSP_022811; Name=12; Synonyms=GPL745, long; IsoId=Q8NI17-12; Sequence=VSP_022800
Alternative Sequence
1..110; Missing (in isoform 6); 1; M -> MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM (in isoform 2, isoform 4, isoform 5 and isoform 8); 1; M -> MKLSPQPSCVNLGM (in isoform 3, isoform 7, isoform 9, isoform 10, isoform 11 and isoform 12); 325..732; Missing (in isoform 4); 464..469; GGKGFS -> A (in isoform 7); 469..550; SKTVNSSILQYGLESLKRKTSYIVQVMASTSAGGTNGTSINFKTLSFSVFEIILITSLIGGGLLILIILTVAYGLKKPNKLT -> CKHAHSEVEKNPKPQIDAMDRPVVGMAPPSHCDLQPGMNHLASLNLSENGAKSTHLLGFWGLNESEVTVPERRVLRKWKELL (in isoform 8); 498..501; TSAG -> YSGG (in isoform 7); 502..732; Missing (in isoform 7); 548..732; Missing (in isoform 9); 551..732; Missing (in isoform 8); 593..613; LKPCSTPSDKLVIDKLVVNFG -> KGSELGTKLKFKPLISLDCAF (in isoform 11); 593..598; LKPCST -> RARYQA (in isoform 10); 599..732; Missing (in isoform 10); 614..732; Missing (in isoform 11); 639..649; YVTCPFRPDCP -> TRILSSCPTSI (in isoform 3 and isoform 5); 650..732; Missing (in isoform 3 and isoform 5)
3D Structural Models
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Domain (FT)
24..122; Fibronectin type-III 1; 124..225; Fibronectin type-III 2; 223..315; Fibronectin type-III 3; 319..416; Fibronectin type-III 4; 421..515; Fibronectin type-III 5
Protein Families (2)
- Type I cytokine receptor family
- Type 2 subfamily
Sequence Similarities
Belongs to the type I cytokine receptor family. Type 2 subfamily.
Clinical Relevance
Disease Involvement (2)
AmyloidosisDisease variant
Related Diseases
Drugs
Antibody
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No related sentences available |