Protein detail

PPTC7

Protein phosphatase PTC7 homolog (EC 3.1.3.16) (T-cell activation protein phosphatase 2C) (TA-PP2C) (T-cell activation protein phosphatase 2C-like)

Entry name PPTC7	UniProt ID Q8NI37	EVMP confidence score 0.38
Supporting publications (n) 2	Transmembrane count	Protein classification EnzymesPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Protein phosphatase PTC7 homolog (EC 3.1.3.16) (T-cell activation protein phosphatase 2C) (TA-PP2C) (T-cell activation protein phosphatase 2C-like)

Protein Class (2)

EnzymesPredicted intracellular proteins

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Ensembl

ENSG00000196850

Entrez Gene Symbol

PPTC7

Gene Synonym

TA-PP2C

Gene Description

Protein phosphatase targeting COQ7

Chromosome

Position

110533245-110583318

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization6

Tissue SpecificepididymisCell SpecificAlveolar cells type 2Single-Nuclei Brain Specificdeep-layer corticothalamic and 6bBlood Cell Specificclassical monocyteBlood Lineage Specificdendritic cells

Function & Pathway5

Protein Function (3)

Enzymes
Predicted intracellular proteins
ENZYME proteins:Hydrolases

Cellular Component (2)

Molecular Function (4)

Biological Process (3)

Mediation Categories

Metabolism mediation

Relations & Evidence12

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (7)

7 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
PPTC7 SEC14L2 SEC14L4 TRIB3 UBC	O76054 P0CG48 Q8NI37 Q96RU7 Q9UDX3	1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5087
PPTC7 SEC14L2 SEC14L4 SLC2A8 UBC	O76054 P0CG48 Q8NI37 Q9NY64 Q9UDX3	1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6073
BLVRA PPTC7 RRAGB RTN4IP1 TRMT2B	P53004 Q5VZM2 Q8NI37 Q8WWV3 Q96GJ1	0:0:0:0:0	hu.MAP2
FMC1 MOCS1 OXLD1 PPTC7 TRMT2B	Q5BKU9 Q8NI37 Q96GJ1 Q96HJ9 Q9NZB8	0:0:0:0:0	hu.MAP2
PPTC7 RTN4IP1	Q8NI37 Q8WWV3	0:0	hu.MAP2
FOXRED1 PPTC7 RTN4IP1	Q8NI37 Q8WWV3 Q96CU9	0:0:0	hu.MAP2
FOXRED1 PPTC7 RTN4IP1 TRMT2B	Q8NI37 Q8WWV3 Q96CU9 Q96GJ1	0:0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyMicrofluidics-Based Methods	Mass spectrometry	34	33718342 36406491 37862381 39949490 31508500 34681663 38225453 39873726 40545963 38644352 32795414 38731868 25950383 26801919 26884841 27723984 28242843 30353492 30550287 30608700 33709510 34202855 27312428 30975894 37686366 38490958 28396511 30760538 31320591 41216884 40311616 40091455 30451371 41315767

Sequence, Structure & Domains6

Sequences

Length

304

Mass

32,646

Sequence

MFSVLSYGRLVARAVLGGLSQTDPRAGGGGGGDYGLVTAGCGFGKDFRKGLLKKGACYGDDACFVARHRSADVLGVADGVGGWRDYGVDPSQFSGTLMRTCERLVKEGRFVPSNPIGILTTSYCELLQNKVPLLGSSTACIVVLDRTSHRLHTANLGDSGFLVVRGGEVVHRSDEQQHYFNTPFQLSIAPPEAEGVVLSDSPDAADSTSFDVQLGDIILTATDGLFDNMPDYMILQELKKLKNSNYESIQQTARSIAEQAHELAYDPNYMSPFAQFACDNGLNVRGGKPDDITVLLSIVAEYTD

Domain & Motif Annotations

Domain (FT)

69..299; PPM-type phosphatase

Protein Families

PP2C family

Sequence Similarities

Belongs to the PP2C family.

Clinical Relevance4

Antibody (2)

HPA039335 HPA040614

Interaction Protein (3)

ENSG00000151012ENSG00000171103ENSG00000176171

Interaction Count

Interaction Dataset (2)

biogrid_bioplexintact_biogrid_bioplex

Supporting Publications2

PMID	Title	Abstract
34265469	Proteomic Landscape of Exosomes Reveals the Functional Contributions of CD151 in Triple-Negative Breast Cancer.	Furthermore, utilizing quantitative proteomics approach to reveal the proteomes of CD151-deleted exosomes and cells, we found that exosomal CD151 facilitated secretion of ribosomal proteins via exosomes while inhibiting exosome secretion of complement proteins. Moreover, we proved that CD151-deleted exosomes significantly decreased the migration and invasion of TNBC cells. Most importantly, we found that the tetraspanin CD151 expression levels in TNBC-derived serum exosomes were significantly higher than those exosomes from healthy subjects, and we validated our findings with samples from 16 additional donors. This is the first comparative study of the proteomes of TNBC patient-derived and CD151-deleted exosomes.
36573687	Proteomic and phosphoproteomic landscape of salivary extracellular vesicles to assess OSCC therapeutical outcomes.	No abstract available