Protein detail
SPP2B
Signal peptide peptidase-like 2B (SPP-like 2B) (SPPL2b) (EC 3.4.23.-) (Intramembrane protease 4) (IMP-4) (Presenilin homologous protein 4) (PSH4) (Presenilin-like protein 1)
Entry name SPP2B | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 2 | Transmembrane count 9 | Protein classification EnzymesPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Signal peptide peptidase-like 2B (SPP-like 2B) (SPPL2b) (EC 3.4.23.-) (Intramembrane protease 4) (IMP-4) (Presenilin homologous protein 4) (PSH4) (Presenilin-like protein 1)
Protein Class (2)
EnzymesPredicted membrane proteins
Protein Function (2)
- Peptidases:Aspartic-type peptidases
- Enzymes
Transmembrane
175..195; Helical; 222..244; Helical; 249..271; Helical; 294..314; Helical; 320..340; Helical; 349..369; Helical; 413..433; Helical; 446..466; Helical; 471..491; Helical
Transmembrane Count
9
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
IMP4KIAA1532PSL1
Gene Description
Signal peptide peptidase like 2B
Chromosome
19
Position
2328615-2355095
Supporting publications (n)
2
EVMP confidence score
0.28
Fluorescence & Localization
Tissue SpecificliverCell SpecificcDCSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell Specificplasmacytoid DCBlood Lineage Specificdendritic cellsSecretome LocationIntracellular and membraneSecretome FunctionReceptor
Function & Pathway
Protein Function (2)
- Peptidases:Aspartic-type peptidases
- Enzymes
Cellular Component (11)
- GO:0000139 Golgi membrane
- GO:0005654 nucleoplasm
- GO:0005765 lysosomal membrane
- GO:0005813 centrosome
- GO:0005886 plasma membrane
- GO:0010008 endosome membrane
- GO:0015629 actin cytoskeleton
- GO:0016020 membrane
- GO:0030660 Golgi-associated vesicle membrane
- GO:0098553 lumenal side of endoplasmic reticulum membrane
Page 1 of 2
Molecular Function (3)
Biological Process (3)
Canonical Pathways (3)
- M5883 Naba secreted factors
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories (2)
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence20
Ligand-Receptor Signaling (18)
18 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | UniProt_location | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes | ||||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane | transmembrane | TopDB | Yes | ||||
| transmembrane | transmembrane | LOCATE | Yes | ||||
| transmembrane | transmembrane | Ramilowski_location | Yes |
Page 1 of 2Next
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationDensity Gradient CentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyMicrofluidics-Based Methods | Mass spectrometry | 41 | 3371834237862381392904593994949028054239315085003410865938225453398737264122729640545963394435443279541434341426231615132450511426801919268848412772398430550287306087003229583333709510337292553420285537926697390229904078452922106071273124283768636638164498384909583076053841216884403116164009145531588238331147683132059137309723 |
Sequence, Structure & Domains
Sequences
Length
592
Mass
64,644
Sequence
MAAAVAAALARLLAAFLLLAAQVACEYGMVHVVSQAGGPEGKDYCILYNPQWAHLPHDLSKASFLQLRNWTASLLCSAADLPARGFSNQIPLVARGNCTFYEKVRLAQGSGARGLLIVSRERLVPPGGNKTQYDEIGIPVALLSYKDMLDIFTRFGRTVRAALYAPKEPVLDYNMVIIFIMAVGTVAIGGYWAGSRDVKKRYMKHKRDDGPEKQEDEAVDVTPVMTCVFVVMCCSMLVLLYYFYDLLVYVVIGIFCLASATGLYSCLAPCVRRLPFGKCRIPNNSLPYFHKRPQARMLLLALFCVAVSVVWGVFRNEDQWAWVLQDALGIAFCLYMLKTIRLPTFKACTLLLLVLFLYDIFFVFITPFLTKSGSSIMVEVATGPSDSATREKLPMVLKVPRLNSSPLALCDRPFSLLGFGDILVPGLLVAYCHRFDIQVQSSRVYFVACTIAYGVGLLVTFVALALMQRGQPALLYLVPCTLVTSCAVALWRRELGVFWTGSGFAKVLPPSPWAPAPADGPQPPKDSATPLSPQPPSEEPATSPWPAEQSPKSRTSEEMGAGAPMREPGSPAESEGRDQAQPSPVTQPGASA
Alternative Products
Event=Alternative splicing; Named isoforms=3; Comment=Experimental confirmation may be lacking for some isoforms.; Name=1; IsoId=Q8TCT7-1; Sequence=Displayed; Name=2; IsoId=Q8TCT7-2; Sequence=VSP_005204; Name=4; IsoId=Q8TCT7-4; Sequence=VSP_009221, VSP_009222
Alternative Sequence
320..592; Missing (in isoform 2); 506..511; KVLPPS -> VNTSLL (in isoform 4); 512..592; Missing (in isoform 4)
Domain & Motif Annotations
Compositional Bias
512..524; Pro residues; 580..592; Polar residues
Motif
472..474; PAL
Domain (CC)
The PAL motif is required for normal active site conformation. The catalytic domains embedded in the membrane are in the opposite orientation to that of the presenilin protein family; therefore, it is predicted to cleave type II-oriented substrate peptides like the prototypic protease SPP.
Domain (FT)
71..149; PA
Region
512..592; Disordered
Protein Families
Peptidase A22B family
Sequence Similarities
Belongs to the peptidase A22B family.
Clinical Relevance
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No related sentences available |
| 40784529 | Serum-derived exosome proteomics unveils the distinct and adjustable nature of the dampness constitution in traditional Chinese medicine. | No related sentences available |