Protein detail

BICD2

Protein bicaudal D homolog 2 (Bic-D 2)

Entry name BICD2	UniProt ID Q8TD16	EVMP confidence score 0.50
Supporting publications (n) 6	Transmembrane count	Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Protein bicaudal D homolog 2 (Bic-D 2)

Protein Class (3)

Disease related genesHuman disease related genesPredicted intracellular proteins

Protein Function (3)

Human disease related genes:Nervous system diseases:Neurodegenerative diseases
Disease related genes
Predicted intracellular proteins

Ensembl

ENSG00000185963

Entrez Gene Symbol

BICD2

Gene Synonym

KIAA0699

Gene Description

BICD cargo adaptor 2

Chromosome

Position

92711363-92764833

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization2

Cell SpecificCytotrophoblasts

Function & Pathway7

Protein Function (3)

Human disease related genes:Nervous system diseases:Neurodegenerative diseases
Disease related genes
Predicted intracellular proteins

Cellular Component (9)

Molecular Function (6)

Biological Process (3)

KEGG

hsa03250 Viral life cycle - HIV-1

Reactome (5)

Mediation Categories

Fusion and delivery mediation

Relations & Evidence14

Enzyme-Mediated Modification (2)

2 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
BICD2	GSK3B	P49841	S	582	phosphorylation	KEA	KEA:17570479
BICD2	MAPK9	P45984	S	582	phosphorylation	KEA	KEA:17570479

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
RBP2	P49792	BICD2	Q8TD16	Yes	Yes	No	SIGNOR	SIGNOR:20386726

Protein Complex Composition (5)

5 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
BICD2 LSM2 LSM3 LSM6	P62310 P62312 Q8TD16 Q9Y333	0:0:0:0	hu.MAP
BICD2 LSM2 LSM3	P62310 Q8TD16 Q9Y333	0:0:0	hu.MAP
BICD2	Q8TD16	2	PDB	PDB:6ofp
BICD2 LSM2	Q8TD16 Q9Y333	0:0	hu.MAP
BICD2 DYNC1LI1	Q8TD16 Q9Y6G9	2:1	PDB	PDB:6pse

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	1	31805958

Sequence, Structure & Domains13

Sequences

Length

824

Mass

93,533

Sequence

MSAPSEEEEYARLVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFEELEVDYEAIRSEMEQLKEAFGQAHTNHKKVAADGESREESLIQESASKEQYYVRKVLELQTELKQLRNVLTNTQSENERLASVAQELKEINQNVEIQRGRLRDDIKEYKFREARLLQDYSELEEENISLQKQVSVLRQNQVEFEGLKHEIKRLEEETEYLNSQLEDAIRLKEISERQLEEALETLKTEREQKNSLRKELSHYMSINDSFYTSHLHVSLDGLKFSDDAAEPNNDAEALVNGFEHGGLAKLPLDNKTSTPKKEGLAPPSPSLVSDLLSELNISEIQKLKQQLMQMEREKAGLLATLQDTQKQLEHTRGSLSEQQEKVTRLTENLSALRRLQASKERQTALDNEKDRDSHEDGDYYEVDINGPEILACKYHVAVAEAGELREQLKALRSTHEAREAQHAEEKGRYEAEGQALTEKVSLLEKASRQDRELLARLEKELKKVSDVAGETQGSLSVAQDELVTFSEELANLYHHVCMCNNETPNRVMLDYYREGQGGAGRTSPGGRTSPEARGRRSPILLPKGLLAPEAGRADGGTGDSSPSPGSSLPSPLSDPRREPMNIYNLIAIIRDQIKHLQAAVDRTTELSRQRIASQELGPAVDKDKEALMEEILKLKSLLSTKREQITTLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYITQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLELLELDHEQTRRGRAKAAPKTKPATPSL

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8TD16-1; Sequence=Displayed; Name=2; IsoId=Q8TD16-2; Sequence=VSP_007969

Alternative Sequence

824; L -> VSHTCACASDRAEGTGLANQVFCSEKHSIYCD (in isoform 2)

3D Structural Models

Helix

6..16; 19..78; 715..740; 743..799

3D Structure

X-ray crystallography (2)

Domain & Motif Annotations

Compositional Bias

402..422; Basic and acidic residues; 604..618; Low complexity

Coiled Coil

20..269; 338..537; 666..808

Domain (CC)

The fourth coiled coil region is involved in Golgi targeting and in the interaction with DCTN2..

Region

25..398; Interacts with DYNLL1, DYNC1H1, DYNC1I2, DCTN1 and DCTN2; 311..330; Disordered; 334..599; Interaction with KIF5A; 398..425; Disordered; 559..622; Disordered; 590..824; Interaction with RANBP2; 666..814; Interacts with RAB6A; 804..824; Disordered

Protein Families

BicD family

Sequence Similarities

Belongs to the BicD family.

Clinical Relevance5

Disease Involvement (2)

Disease variantNeurodegeneration

Antibody (2)

HPA023013 HPA024452

Interaction Protein (3)

ENSG00000101367ENSG00000158560ENSG00000175582

Interaction Count

Interaction Dataset (2)

biogrid_opencellintact_biogrid

Supporting Publications6

PMID	Title	Abstract
30915084	Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton.	No abstract available
37322475	Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration.	No abstract available
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available
40189497	Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis.	No abstract available
40465195	Extracellular vesicle proteomics uncovers energy metabolism, complement system, and endoplasmic reticulum stress response dysregulation postexercise in males with myalgic encephalomyelitis/chronic fatigue syndrome.	No abstract available
40985879	TurboID-Mediated Profiling of Glioblastoma-Derived Extracellular Vesicle Cargo Proteins.	No abstract available