Protein detail
KCNG4
Voltage-gated potassium channel regulatory subunit KCNG4 (Potassium voltage-gated channel subfamily G member 4) (Voltage-gated potassium channel subunit Kv6.3) (Voltage-gated potassium channel subunit Kv6.4)
Entry name KCNG4 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 6 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Voltage-gated potassium channel regulatory subunit KCNG4 (Potassium voltage-gated channel subfamily G member 4) (Voltage-gated potassium channel subunit Kv6.3) (Voltage-gated potassium channel subunit Kv6.4)
Protein Function (2)
- Transporters:Transporter channels and pores
- Voltage-gated ion channels:Voltage-Gated Potassium Channels
Transmembrane
219..240; Helical; Name=Segment S1; 262..283; Helical; Name=Segment S2; 295..314; Helical; Name=Segment S3; 329..353; Helical; Voltage-sensor; Name=Segment S4; 369..390; Helical; Name=Segment S5; 433..461; Helical; Name=Segment S6
Transmembrane Count
6
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization2
Cell SpecificAstrocytes
Function & Pathway7
Protein Function (2)
- Transporters:Transporter channels and pores
- Voltage-gated ion channels:Voltage-Gated Potassium Channels
Cellular Component (4)
Molecular Function (2)
Biological Process (3)
Reactome (3)
Canonical Pathways (2)
- M159 Pid amb2 neutrophils pathway
- M28 Pid il4 2pathway
Mediation Categories
Fusion and delivery mediation
Relations & Evidence33
Ligand-Receptor Signaling (30)
30 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transporter | transporter | Surfaceome | No | Yes | No | No | No |
| potassium_channels | transporter | Surfaceome | No | Yes | No | No | No |
| channels | transporter | Surfaceome | No | Yes | No | No | No |
| ion_channel | ion_channel | DGIdb | No | Yes | No | No | No |
| voltage_gated_potassium | ion_channel | HGNC | No | Yes | No | No | No |
| ion_channel | ion_channel | HGNC | No | Yes | No | No | No |
Page 1 of 3Next
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Immunoelectron MicroscopyMass spectrometry | 1 | 22329422 |
Sequence, Structure & Domains10
Sequences
Length
519
Mass
58,979
Sequence
MPMPSRDGGLHPRHHHYGSHSPWSQLLSSPMETPSIKGLYYRRVRKVGALDASPVDLKKEILINVGGRRYLLPWSTLDRFPLSRLSKLRLCRSYEEIVQLCDDYDEDSQEFFFDRSPSAFGVIVSFLAAGKLVLLQEMCALSFQEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRPASHSSRWGLCMNRLREMVENPQSGLPGKVFACLSILFVATTAVSLCVSTMPDLRAEEDQGECSRKCYYIFIVETICVAWFSLEFCLRFVQAQDKCQFFQGPLNIIDILAISPYYVSLAVSEEPPEDGERPSGSSYLEKVGLVLRVLRALRILYVMRLARHSLGLQTLGLTVRRCTREFGLLLLFLAVAITLFSPLVYVAEKESGRVLEFTSIPASYWWAIISMTTVGYGDMVPRSVPGQMVALSSILSGILIMAFPATSIFHTFSHSYLELKKEQEQLQARLRHLQNTGPASECELLDPHVASEHELMNDVNDLILEGPALPIMHM
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8TDN1-1; Sequence=Displayed; Name=2; IsoId=Q8TDN1-2; Sequence=VSP_001029, VSP_001030
Alternative Sequence
253..256; GECS -> VSGL (in isoform 2); 257..519; Missing (in isoform 2)
Domain & Motif Annotations
Motif
418..423; Selectivity filter
Domain (CC)
The transmembrane segment S4 functions as a voltage-sensor and is characterized by a series of positively charged amino acids at every third position. Channel opening and closing is effected by a conformation change that affects the position and orientation of the voltage-sensor paddle formed by S3 and S4 within the membrane. A transmembrane electric field that is positive inside would push the positively charged S4 segment outwards, thereby opening the pore, while a field that is negative inside would pull the S4 segment inwards and close the pore. Changes in the position and orientation of S4 are then transmitted to the activation gate formed by the inner helix bundle via the S4-S5 linker region.
Region
1..25; Disordered
Protein Families (3)
- Potassium channel family
- G (TC 1.A.1.2) subfamily
- Kv6.4/KCNG4 sub-subfamily
Sequence Similarities
Belongs to the potassium channel family. G (TC 1.A.1.2) subfamily. Kv6.4/KCNG4 sub-subfamily.
Clinical Relevance1
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 40689422 | Defining the Ovarian Cancer Precancerous Landscape through Modeling Fallopian Tube Epithelium Reprogramming Driven by Extracellular Vesicles. | No abstract available |