Protein detail

GP148

Probable G-protein coupled receptor 148 (Brain and testis restricted GPCR) (G-protein coupled receptor PGR6)

Entry name GP148	UniProt ID Q8TDV2	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count 7	Protein classification G-protein coupled receptorsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Probable G-protein coupled receptor 148 (Brain and testis restricted GPCR) (G-protein coupled receptor PGR6)

Protein Class (2)

G-protein coupled receptorsPredicted membrane proteins

Protein Function

G-protein coupled receptors:GPCRs excl olfactory receptors

Transmembrane

52..72; Helical; Name=1; 86..106; Helical; Name=2; 131..151; Helical; Name=3; 166..186; Helical; Name=4; 215..235; Helical; Name=5; 262..282; Helical; Name=6; 300..322; Helical; Name=7

Transmembrane Count

Ensembl

ENSG00000173302

Entrez Gene Symbol

GPR148

Gene Synonym

PGR6

Gene Description

G protein-coupled receptor 148

Chromosome

Position

130729070-130730336

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization1

Cell SpecificEarly spermatids

Function & Pathway6

Protein Function

G-protein coupled receptors:GPCRs excl olfactory receptors

Cellular Component (2)

Molecular Function (4)

Biological Process (3)

Canonical Pathways (3)

M5880 Naba ecm affiliated
M5885 Naba matrisome associated
M5889 Naba matrisome

Mediation Categories

Other mediation

Relations & Evidence37

Ligand-Receptor Signaling (36)

36 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	HPMR	No	Yes	No	Yes	No
receptor	receptor	Surfaceome	No	Yes	No	Yes	No
gpcr	receptor	DGIdb	No	Yes	No	Yes	No
gpcr	receptor	Almen2009	No	Yes	No	Yes	No
rhodopsin	receptor	Almen2009	No	Yes	No	Yes	No
gpcr	receptor	UniProt_keyword	No	Yes	No	Yes	No
seven_transmembrane_7tm	receptor	HPMR	No	Yes	No	Yes	No
7tm_a	receptor	HPMR	No	Yes	No	Yes	No
7tm_a_orphan_7tm_a	receptor	HPMR	No	Yes	No	Yes	No
rhodopsin	receptor	Surfaceome	No	Yes	No	Yes	No

Page 1 of 4Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry	18	40985879 38207106 36064647 38113368 40465195 37322475 40189497 41068253 33592500 38917926 41307968 36146834 33309826 40840701 31805958 39207047 32854315 37926756

Sequence, Structure & Domains5

Sequences

Length

347

Mass

38,288

Sequence

MGDELAPCPVGTTAWPALIQLISKTPCMPQAASNTSLGLGDLRVPSSMLYWLFLPSSLLAAATLAVSPLLLVTILRNQRLRQEPHYLLPANILLSDLAYILLHMLISSSSLGGWELGRMACGILTDAVFAACTSTILSFTAIVLHTYLAVIHPLRYLSFMSHGAAWKAVALIWLVACCFPTFLIWLSKWQDAQLEEQGASYILPPSMGTQPGCGLLVIVTYTSILCVLFLCTALIANCFWRIYAEAKTSGIWGQGYSRARGTLLIHSVLITLYVSTGVVFSLDMVLTRYHHIDSGTHTWLLAANSEVLMMLPRAMLTYLYLLRYRQLLGMVRGHLPSRRHQAIFTIS

Domain & Motif Annotations

Protein Families

G-protein coupled receptor 1 family

Sequence Similarities

Belongs to the G-protein coupled receptor 1 family.

Clinical Relevance1

Antibody (2)

HPA046655 HPA060527

Supporting Publications1

PMID	Title	Abstract
38113368	In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.	No abstract available