Protein detail
NEUFC
Neuferricin (Cytochrome b5 domain-containing protein 2)
Entry name NEUFC | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 4 | Transmembrane count | Protein classification Predicted intracellular proteinsPredicted secreted proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Neuferricin (Cytochrome b5 domain-containing protein 2)
Protein Class (2)
Predicted intracellular proteinsPredicted secreted proteins
Protein Function (2)
- Predicted secreted proteins
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
MGC32124
Gene Description
Cytochrome b5 domain containing 2
Chromosome
17
Position
4143168-4187310
Supporting publications (n)
4
EVMP confidence score
0.38
Fluorescence & Localization3
Tissue Specificskeletal muscleCell SpecificErythrocyte progenitorsSingle-Nuclei Brain Specificendothelial cell
Function & Pathway5
Protein Function (2)
- Predicted secreted proteins
- Predicted intracellular proteins
Cellular Component (3)
Molecular Function (2)
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence17
Ligand-Receptor Signaling (14)
14 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | No | Yes | Yes | No |
| ecm | ecm | OmniPath | Yes | No | Yes | Yes | No |
| extracellular | extracellular | OmniPath | No | No | Yes | Yes | No |
| intracellular | intracellular | ComPPI | No | No | Yes | Yes | No |
| intracellular | intracellular | OmniPath | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | Yes | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | Yes | Yes | No |
| secreted | secreted | UniProt_keyword | No | No | Yes | Yes | No |
| secreted | secreted | UniProt_location | No | No | Yes | Yes | No |
| secreted | secreted | HPA_secretome | No | No | Yes | Yes | No |
Page 1 of 2Next
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationDensity Gradient CentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography | Western blottingFACSMass spectrometryAntibody array|Mass spectrometry [LTQ-FT Ultra] | 9 | 157907842052967221336773218197043638616337646133381037553825777238767348 |
Sequence, Structure & Domains9
Sequences
Length
264
Mass
28,690
Sequence
MLRCGGRGLLLGLAVAAAAVMAARLMGWWGPRAGFRLFIPEELSRYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGSHYSGFAGRDASRAFVTGDCSEAGLVDDVSDLSAAEMLTLHNWLSFYEKNYVCVGRVTGRFYGEDGLPTPALTQVEAAITRGLEANKLQLQEKQTFPPCNAEWSSARGSRLWCSQKSGGVSRDWIGVPRKLYKPGAKEPRCVCVRTTGPPSGQMPDNPPHRNRGDLDHPNLAEYTGCPPLAITCSFPL
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8WUJ1-1; Sequence=Displayed; Name=2; IsoId=Q8WUJ1-3; Sequence=VSP_045028
Alternative Sequence
1..112; Missing (in isoform 2)
Domain & Motif Annotations
Domain (CC)
The cytochrome b5 heme-binding domain was proven to bind heme, although it lacks the conserved iron-binding His residues at position 73 and 106..
Domain (FT)
35..134; Cytochrome b5 heme-binding
Protein Families (2)
- Cytochrome b5 family
- MAPR subfamily
Sequence Similarities
Belongs to the cytochrome b5 family. MAPR subfamily.
Supporting Publications4
| PMID | Title | Abstract |
|---|---|---|
| 32560723 | T2 and T17 cytokines alter the cargo and function of airway epithelium-derived extracellular vesicles. | No abstract available |
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No abstract available |
| 38716512 | Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics. | No abstract available |