Protein detail
BLNK
B-cell linker protein (B-cell adapter containing a SH2 domain protein) (B-cell adapter containing a Src homology 2 domain protein) (Cytoplasmic adapter protein) (Src homology 2 domain-containing leukocyte protein of 65 kDa) (SLP-65)
Protein symbol BLNK | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count | Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
B-cell linker protein (B-cell adapter containing a SH2 domain protein) (B-cell adapter containing a Src homology 2 domain protein) (Cytoplasmic adapter protein) (Src homology 2 domain-containing leukocyte protein of 65 kDa) (SLP-65)
Protein Class
Disease related genesHuman disease related genesPredicted intracellular proteins
Protein Function
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Disease related genes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
BASHbcaBLNK-sLy57SLP-65SLP65
Gene Description
B cell linker
Chromosome
10
Position
96189171-96271587
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Tissue Specificblood vesselCell SpecificBergmann gliaSingle-Nuclei Brain SpecificastrocyteBlood Cell SpecificgdT-cellBlood Lineage SpecificT-cells
Function & Pathway
Protein Function
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Disease related genes
- Predicted intracellular proteins
Cellular Component
Molecular Function
- GO:0005068 transmembrane receptor protein tyrosine kinase adaptor activity
- GO:0005515 protein binding
- GO:0008289 lipid binding
- GO:0019899 enzyme binding
- GO:0019901 protein kinase binding
- GO:0035591 signaling adaptor activity
- GO:0042169 SH2 domain binding
- GO:0043274 phospholipase binding
- GO:0140693 molecular condensate scaffold activity
- GO:1990782 protein tyrosine kinase binding
Biological Process
KEGG
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-983695 antigen activates b cell receptor bcr leading to generation of second messengers
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-5663205 infectious disease
- R-hsa-512988 interleukin 3 interleukin 5 and gm csf signaling
- R-hsa-9679191 potential therapeutics for sars
- R-hsa-912631 regulation of signaling by cbl
- R-hsa-9679506 sars cov infections
- R-hsa-449147 signaling by interleukins
- R-hsa-983705 signaling by the b cell receptor bcr
- R-hsa-9824446 viral infection pathways
Mediation Categories
Clinical-translation mediationImmune mediation
Relations & Evidence
Enzyme-Mediated Modification
15 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| BLNK | IKZF1 | Q13422 | Y | 96 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:19620627 |
| BLNK | MAP4K1 | Q92918 | T | 152 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:27381982 |
| BLNK | HCK | P08631 | Y | 96 | phosphorylation | KEA | KEA:17570479 |
| BLNK | IGF1R | P08069 | Y | 72 | phosphorylation | KEA | KEA:17570479 |
| BLNK | IGF1R | P08069 | Y | 96 | phosphorylation | KEA | KEA:17570479 |
Page 2 of 2Previous
Ligand-Receptor Signaling
7 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KSYK | P43405 | BLNK | Q8WV28 | Yes | Yes | No | KEGG-MEDICUSSIGNORProtMapperdbPTMPhosphoSite_KEAphosphoELM_KEALi2012PhosphoNetworksHPRDCui2007Kinexus_KEAWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapperPhosphoSiteSparser_ProtMapperSPIKE_LCSPIKE | phosphoELM:9697839ProtMapper:12456653PhosphoSite:9697839HPRD:10981967ProtMapper:21047529SPIKE:9697839SPIKE_LC:18369315KEA:9697839dbPTM:12456653phosphoELM:12456653SIGNOR:12456653SPIKE_LC:9697839KEA:12456653SPIKE_LC:16189514 |
| SH2B1 | Q9NRF2 | BLNK | Q8WV28 | Yes | No | Yes | SIGNOR | SIGNOR:32323266 |
| PTPRG | P23470 | BLNK | Q8WV28 | Yes | Yes | No | SIGNOR_ProtMapperSIGNORProtMapper | SIGNOR:25624455ProtMapper:25624455 |
Protein Complex Composition
Sequence, Structure & Domains
Sequences
Length
456
Mass
50,466
Sequence
MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEEQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVS
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8WV28-1; Sequence=Displayed; Name=2; IsoId=Q8WV28-2; Sequence=VSP_016178; Name=3; IsoId=Q8WV28-3; Sequence=VSP_045324
Alternative Sequence
203..225; Missing (in isoform 2); 366..417; Missing (in isoform 3)
3D Structural Models
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Compositional Bias
57..74; Acidic residues; 173..187; Acidic residues; 212..226; Low complexity; 236..245; Pro residues; 251..260; Low complexity; 271..289; Basic and acidic residues
Domain (FT)
346..453; SH2
Region
36..301; Disordered