Protein detail

CC107

Coiled-coil domain-containing protein 107

Entry name CC107	UniProt ID Q8WV48	EVMP confidence score 0.50
Supporting publications (n) 2	Transmembrane count 1	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information7

Protein Names

Coiled-coil domain-containing protein 107

Transmembrane

65..85; Helical

Transmembrane Count

Ensembl

ENSG00000159884

Entrez Gene Symbol

CCDC107

Supporting publications (n)

EVMP confidence score

0.50

Function & Pathway4

Cellular Component

GO:0016020 membrane

Molecular Function

GO:0005515 protein binding

Biological Process (3)

Mediation Categories

Other mediation

Relations & Evidence8

Ligand-Receptor Signaling (7)

7 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
transmembrane	transmembrane	UniProt_location	No	No	No	No	No
transmembrane	transmembrane	UniProt_topology	No	No	No	No	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	No	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry	14	40985879 38207106 37926756 36064647 38113368 35119778 37322475 34064677 26826536 40189497 36146834 27821849 38207106 38716512

Sequence, Structure & Domains8

Sequences

Length

283

Mass

30,509

Sequence

MAGAVSLLGVVGLLLVSALSGVLGDRANPDLRAHPGNAAHPGSGATEPRRRPPLKDQRERTRAGSLPLGALYTAAVAAFVLYKCLQGKDETAVLHEEASKQQPLQSEQQLAQLTQQLAQTEQHLNNLMAQLDPLFERVTTLAGAQQELLNMKLWTIHELLQDSKPDKDMEASEPGEGSGGESAGGGDKVSETGTFLISPHTEASRPLPEDFCLKEDEEEIGDSQAWEEPTNWSTETWNLATSWEVGRGLRRRCSQAVAKGPSHSLGWEGGTTAEGRLKQSLFS

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=Q8WV48-1; Sequence=Displayed; Name=2; IsoId=Q8WV48-2; Sequence=VSP_024130, VSP_024133; Name=3; IsoId=Q8WV48-3; Sequence=VSP_024131, VSP_024132; Name=4; IsoId=Q8WV48-4; Sequence=VSP_024128, VSP_024129; Name=5; IsoId=Q8WV48-5; Sequence=VSP_042165

Alternative Sequence

107..119; EQQLAQLTQQLAQ -> GGFSRSLCWVGGV (in isoform 4); 120..283; Missing (in isoform 4); 138..155; VTTLAGAQQELLNMKLWT -> PAGASEHEAMDHPRAAAR (in isoform 2); 138..139; VT -> SF (in isoform 3); 140..283; Missing (in isoform 3); 156..283; Missing (in isoform 2); 175..201; Missing (in isoform 5)

Domain & Motif Annotations

Compositional Bias

47..62; Basic and acidic residues; 176..187; Gly residues

Coiled Coil

104..134

Region

30..62; Disordered; 164..207; Disordered; 258..283; Disordered

Supporting Publications2

PMID	Title	Abstract
37547182	Retroviral b-Zip protein (HBZ) contributes to the release of soluble and exosomal immune checkpoint molecules in the context of neuroinflammation.	For the very first time, we demonstrate a unique elevated presence of several stimulatory (CD27, CD28, 4-1BB) and inhibitory (BTLA, CTLA-4, LAG-3, PD-1, PD-L2) ICP receptors in HAM/TSP sera, and in purified exosomes from a HAM/TSP-derived HTLV-1-producing (OSP2) cells.
38926392	Macrophage-derived CD36 + exosome subpopulations as novel biomarkers of Candida albicans infection.	Additionally, the CD36 exosome subpopulations, identified through our analysis, could serve as potential biomarkers and therapeutic targets for C. albicans infection. In our study, we analyzed differentially expressed proteins in exosomes from macrophages and C. albicans -infected macrophages, focusing on proteins such as ACE2, CD36, CAV1, LAMP2, CD27, and MPO. We also examined exosome subpopulations, finding a dominant expression of MPO in the most prevalent subgroup, and a distinct expression of CD36 in cluster14.