Protein detail

EFMT1

EEF1A lysine methyltransferase 1 (EC 2.1.1.-) (N(6)-adenine-specific DNA methyltransferase 2) (Protein-lysine N-methyltransferase N6AMT2) (eEF1A-KMT)

Entry name EFMT1	UniProt ID Q8WVE0	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

EEF1A lysine methyltransferase 1 (EC 2.1.1.-) (N(6)-adenine-specific DNA methyltransferase 2) (Protein-lysine N-methyltransferase N6AMT2) (eEF1A-KMT)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000150456

Entrez Gene Symbol

EEF1AKMT1

Gene Synonym

N6AMT2

Gene Description

EEF1A lysine methyltransferase 1

Chromosome

Position

20728731-20773961

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization5

Tissue SpecificintestineCell SpecificFoveolar cellsSingle-Nuclei Brain Specificvascular associated smooth muscle cellBlood Cell SpecificgdT-cellBlood Lineage SpecificT-cells

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component

GO:0005829 cytosol

Molecular Function (4)

Biological Process (3)

Reactome (2)

Mediation Categories

Metabolism mediation

Relations & Evidence9

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (4)

4 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database
EEF1A2 EEF1AKMT1 KHDRBS3 NXPH2 VARS1	O75525 O95156 P26640 Q05639 Q8WVE0	0:0:0:0:0	hu.MAP2
EEF1A2 EEF1AKMT1 KHDRBS3 NXPH2	O75525 O95156 Q05639 Q8WVE0	0:0:0:0	hu.MAP2
CARS1 EEF1A1 EEF1A2 EEF1AKMT1 EEF1D EEF1G KTN1 NXPH2 PBDC1 SLC39A7 TTLL12 VARS1	O95156 P26640 P26641 P29692 P49589 P68104 Q05639 Q14166 Q86UP2 Q8WVE0 Q92504 Q9BVG4	0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP2
EEF1A2 EEF1AKMT1 NXPH2	O95156 Q05639 Q8WVE0	0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	3	39766158 29436780 36398564

Sequence, Structure & Domains5

Sequences

Length

214

Mass

24,506

Sequence

MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAAVGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIADPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGLDCGI

Domain & Motif Annotations

Protein Families (2)

Class I-like SAM-binding methyltransferase superfamily
EFM5 family

Sequence Similarities

Belongs to the class I-like SAM-binding methyltransferase superfamily. EFM5 family.

Clinical Relevance1

Antibody (2)

HPA040417 HPA042543

Supporting Publications1

PMID	Title	Abstract
2780759	The optimal processing of plasma samples for the determination of bicyclo-PGE in patients with malignant maxillofacial tumors.	No abstract available