Protein detail
ASB5
Ankyrin repeat and SOCS box protein 5 (ASB-5)
Entry name ASB5 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 2 | Transmembrane count | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information6
Protein Names
Ankyrin repeat and SOCS box protein 5 (ASB-5)
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Supporting publications (n)
2
EVMP confidence score
0.38
Fluorescence & Localization3
Cell SpecificChoroid plexus epithelial cellsSingle-Nuclei Brain Specificchoroid plexus epithelial cell
Function & Pathway5
Protein Function
Predicted intracellular proteins
Cellular Component
Biological Process (3)
Reactome (5)
Mediation Categories (2)
Immune mediationMetabolism mediation
Relations & Evidence10
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | No | No | No |
| transmembrane_sosui | transmembrane_predicted | Almen2009 | No | No | No | No | No |
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | No | No | No | No | No |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometryWestern blotting|Mass spectrometry | 29 | 4098587938590132360646473811336840465195351197783732247533304478364971843406467726826536401894973138253741068253335925003285431534473505388910773256072332916986361468342782184940840701318059583223097038207106387165123920704737926756 |
Sequence, Structure & Domains10
Sequences
Length
329
Mass
36,341
Sequence
MSVLEENRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYGVTQGQGSWADRSPLHEAASQGRLLALRTLLSQGYNVNAVTLDHVTPLHEACLGDHVACARTLLEAGANVNAITIDGVTPLFNACSQGSPSCAELLLEYGAKAQLESCLPSPTHEAASKGHHECLDILISWGIDVDQEIPHLGTPLYVACMSQQFHCIWKLLYAGADVQKGKYWDTPLHAAAQQSSTEIVNLLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLCIRSYIGKPRLHLIPQLQLPTLLKNFLQYR
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8WWX0-1; Sequence=Displayed; Name=2; IsoId=Q8WWX0-2; Sequence=VSP_054425
Alternative Sequence
1..65; MSVLEENRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYGVTQGQ -> MPLCNGGNLAVT (in isoform 2)
Domain & Motif Annotations
Repeat
69..98; ANK 1; 102..131; ANK 2; 135..164; ANK 3; 167..196; ANK 4; 200..229; ANK 5; 232..261; ANK 6
Domain (CC)
The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes.
Domain (FT)
278..329; SOCS box
Protein Families
Ankyrin SOCS box (ASB) family
Sequence Similarities
Belongs to the ankyrin SOCS box (ASB) family.
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No abstract available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No abstract available |