Protein detail

DNJC9

DnaJ homolog subfamily C member 9 (HDJC9) (DnaJ protein SB73)

Entry name DNJC9	UniProt ID Q8WXX5	EVMP confidence score 0.63
Supporting publications (n) 9	Transmembrane count	Protein classification Essential proteinsPredicted intracellular proteins

Basic Information

Protein Names

DnaJ homolog subfamily C member 9 (HDJC9) (DnaJ protein SB73)

Protein Class (2)

Essential proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000213551

Entrez Gene Symbol

DNAJC9

Gene Synonym (2)

JDD1SB73

Gene Description

DnaJ heat shock protein family (Hsp40) member C9

Chromosome

Position

73183362-73247255

Supporting publications (n)

EVMP confidence score

0.63

Fluorescence & Localization

Tissue SpecificbrainCell SpecificEpididymal principal cells

Function & Pathway

Protein Function

Predicted intracellular proteins

Cellular Component (7)

Molecular Function (4)

Biological Process (3)

Mediation Categories

Other mediation

Relations & Evidence14

Ligand-Receptor Signaling (8)

8 records.

Category	Parent	Database	Transmitter
ecm	ecm	MatrixDB	Yes
ecm	ecm	OmniPath	Yes
intracellular	intracellular	ComPPI
intracellular	intracellular	GO_Intercell
intracellular	intracellular	UniProt_location
intracellular	intracellular	OmniPath
plasma_membrane	plasma_membrane	UniProt_location
plasma_membrane	plasma_membrane	OmniPath

Protein Complex Composition (6)

6 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
DNAJC9 SRP14 SRP19 SRP54 SRP68 SRP72 SRP9	O76094 P09132 P37108 P49458 P61011 Q8WXX5 Q9UHB9	0:0:0:0:0:0:0	hu.MAP2
BMS1 DHX57 DIMT1 DNAJC9 SRP14 SRP68 SRP72 UTP23 YTHDC2	O76094 P37108 Q14692 Q6P158 Q8WXX5 Q9BRU9 Q9H6S0 Q9UHB9 Q9UNQ2	0:0:0:0:0:0:0:0:0	hu.MAP2
DNAJC9 RPL5	P46777 Q8WXX5	0:0	hu.MAP2
DNAJC9 H3-3A H4C4 MCM2	P49736 P62805 P84243 Q8WXX5	3:3:3:3	PDB	PDB:7cizPDB:7cj0
DNAJC9 H2AC21 RPL26	P61254 Q8IUE6 Q8WXX5	0:0:0	hu.MAP2
DNAJC9 GFUS	Q13630 Q8WXX5	0:0	Havugimana2012	Havugimana2012:C_26

Sequence, Structure & Domains

Sequences

Length

260

Mass

29,910

Sequence

MGLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQILGKVYSVLSDREQRAVYDEQGTVDEDSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKTYKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFVKESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDSLKAAIQSRQKDRQKEMDNFLAQMEAKYCKSSKGGGKKSALKKEKK

3D Structural Models

Helix

175..207; 213..242; 244..247

3D Structure

X-ray crystallography (2)

Domain & Motif Annotations

Compositional Bias

193..208; Basic and acidic residues

Domain (CC)

The functional J domain is required for the release from histone-dependent chromatin-binding.

Domain (FT)

15..82; J

Region

171..249; Required for histone binding; 185..208; Disordered

Clinical Relevance

Antibody (2)

HPA035215 HPA035216

Interaction Protein (5)

ENSG00000109971ENSG00000171148ENSG00000196497ENSG00000274750ENSG00000275714

Interaction Count

Interaction Dataset (2)

biogrid_opencellintact_biogrid

Supporting Publications9

PMID	Title	Related sentences
28986585	Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics.	No related sentences available
29436780	Autosomal Tubulointerstitial Kidney Disease-MUC1 Type: Differential Proteomics Suggests that Mutated MUC1 (insC) Affects Vesicular Transport in Renal Epithelial Cells.	No related sentences available
30408591	Portrait of blood-derived extracellular vesicles in patients with Parkinson's disease.	No related sentences available
32284825	Unravelling the proteomic landscape of extracellular vesicles in prostate cancer by density-based fractionation of urine.	No related sentences available
35212939	Novel Exosome Biomarker Candidates for Alzheimer's Disease Unravelled Through Mass Spectrometry Analysis.	Among them are AACT and C4BPα, two Aβ-binding proteins, whose exosome levels were further validated in individuals from independent cohorts using antibody-based approaches.
35611462	Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients.	No related sentences available
39505756	Differential proteomic profiles of exosomes in pediatric and adult adamantinomatous craniopharyngioma cyst fluid.	No related sentences available
39558134	Serum small extracellular vesicles-derived BST2 as a biomarker for papillary thyroid microcarcinoma promotes lymph node metastasis.	No related sentences available
39940923	NHERF2 as a Novel Biomarker for Distinguishing MAC Pulmonary Disease from Tuberculosis Based on Proteome Analysis of Serum Extracellular Vesicles.	No related sentences available