Protein detail
RND1
Rho-related GTP-binding protein Rho6 (Rho family GTPase 1) (Rnd1)
Entry name RND1 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Rho-related GTP-binding protein Rho6 (Rho family GTPase 1) (Rnd1)
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue SpecificbrainCell SpecificLate spermatids
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (5)
Molecular Function (5)
Biological Process (3)
Reactome (9)
- R-hsa-9675108 nervous system development
- R-hsa-9012999 rho gtpase cycle
- R-hsa-9696273 rnd1 gtpase cycle
- R-hsa-399955 sema3a plexin repulsion signaling by inhibiting integrin adhesion
- R-hsa-416572 sema4d induced cell migration and growth cone collapse
- R-hsa-400685 sema4d in semaphorin signaling
- R-hsa-416550 sema4d mediated inhibition of cell attachment and migration
- R-hsa-373755 semaphorin interactions
- R-hsa-9716542 signaling by rho gtpases miro gtpases and rhobtb3
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence13
Ligand-Receptor Signaling (6)
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | OmniPath |
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| GRB7 | Q14451 | RND1 | Q92730 | Yes | Yes | HPRDLit-BM-17SIGNORSignaLink3 | SIGNOR:10664463Lit-BM-17:10664463HPRD:10664463SignaLink3:10664463SignaLink3:23331499 | |
| RND1 | Q92730 | MK08 | P45983 | Yes | Yes | SIGNOR | SIGNOR:17251915 |
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster358 | ARL8AARL8BRHODRHOFRND1RND2RND3 | O00212P52198P61587Q92730Q96BM9Q9HBH0Q9NVJ2 | 1:1:1:1:1:1:1 | Compleat | Compleat:HC1086 | 22036573 |
| Heterotrimeric complex (Rnd1RrasPlxnb1) | PLXNB1RND1RRAS | O43157P10301Q92730 | 1:1:1 | Compleat | Compleat:HC3177 | 15297673 |
| PLXNB1RND1 | O43157Q92730 | 2:2 | PDB | PDB:2rex | ||
| RND1 | Q92730 | 2 | PDB | PDB:2cls |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometry | 18 | 409858794018949738113368404651953511977837322475364971843359250032854315325607234130796836146834278218493344194938207106387165123698231239207047 |
Sequence, Structure & Domains
Sequences
Length
232
Mass
26,056
Sequence
MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
3D Structural Models
Turn
75..77; 169..171
Helix
26..35; 72..74; 78..81; 98..104; 106..114; 127..131; 133..141; 149..159; 173..188
Beta Strand
10..12; 14..19; 46..55; 60..68; 86..93; 118..125; 162..166
3D Structure
X-ray crystallography (3)
Domain & Motif Annotations
Motif
42..50; Effector region
Protein Families (2)
- Small GTPase superfamily
- Rho family
Sequence Similarities
Belongs to the small GTPase superfamily. Rho family.
Clinical Relevance
Interaction Protein (2)
ENSG00000141738ENSG00000164050
Interaction Count
2
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 38037300 | Proteomic profiling of paired human liver homogenate and tissue derived extracellular vesicles. | No related sentences available |