Protein detail

COR2A

Coronin-2A (IR10) (WD repeat-containing protein 2)

Entry name COR2A	UniProt ID Q92828	EVMP confidence score 0.38
Supporting publications (n) 4	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Coronin-2A (IR10) (WD repeat-containing protein 2)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000106789

Entrez Gene Symbol

CORO2A

Gene Synonym (2)

IR10WDR2

Gene Description

Coronin 2A

Chromosome

Position

98120975-98192637

Supporting publications (n)

EVMP confidence score

0.38

Function & Pathway5

Protein Function

Predicted intracellular proteins

Cellular Component

GO:0017053 transcription repressor complex

Molecular Function (2)

Biological Process (3)

Mediation Categories

Other mediation

Relations & Evidence7

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
actin_regulation_adhesome	intracellular_intercellular_related	Adhesome	Yes	No	No	No	No
intracellular_intercellular_related	intracellular_intercellular_related	OmniPath	Yes	No	No	No	No

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
NCOR complex	CORO2A GPS2 HDAC3 NCOR1 TBL1X TBL1XR1	O15379 O60907 O75376 Q13227 Q92828 Q9BZK7	1:1:1:1:1:1	CompleatCORUM	CORUM:15Compleat:HC2029	12628926

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationDensity Gradient CentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometryWestern blottingFlow cytometry	9	38225453 38731868 24505114 36635400 40098346 37922300 36982312 40091455 31588238

Sequence, Structure & Domains7

Sequences

Length

525

Mass

59,763

Sequence

MSWHPQYRSSKFRHVFGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAVVTECAGGGAFLVIPLHQTGKLDPHYPKVCGHRGNVLDVKWNPFDDFEIASCSEDATIKIWSIPKQLLTRNLTAYRKELVGHARRVGLVEWHPTAANILFSAGYDYKVMIWNLDTKESVITSPMSTISCHQDVILSMSFNTNGSLLATTCKDRKIRVIDPRAGTVLQEASYKGHRASKVLFLGNLKKLMSTGTSRWNNRQVALWDQDNLSVPLMEEDLDGSSGVLFPFYDADTSMLYVVGKGDGNIRYYEVSADKPHLSYLTEYRSYNPQKGIGVMPKRGLDVSSCEIFRFYKLITTKSLIEPISMIVPRRSESYQEDIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGWRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQQEEIRRLRELLTQREVQAKQLELEIKNLRMGSEQL

Domain & Motif Annotations

Repeat

24..71; WD 1; 72..122; WD 2; 123..170; WD 3; 171..214; WD 4; 215..259; WD 5; 260..305; WD 6; 306..342; WD 7

Coiled Coil

485..524

Protein Families

WD repeat coronin family

Sequence Similarities

Belongs to the WD repeat coronin family.

Clinical Relevance1

Antibody (2)

HPA041161 HPA041302

Supporting Publications4

PMID	Title	Abstract
27894104	Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers.	No abstract available
33204424	Proteomic analysis of extracellular vesicles reveals an immunogenic cargo in rheumatoid arthritis synovial fluid.	No abstract available
39766158	A Proteomic Examination of Plasma Extracellular Vesicles Across Colorectal Cancer Stages Uncovers Biological Insights That Potentially Improve Prognosis.	No abstract available
39940923	NHERF2 as a Novel Biomarker for Distinguishing MAC Pulmonary Disease from Tuberculosis Based on Proteome Analysis of Serum Extracellular Vesicles.	No abstract available