Protein detail

NEO1

Neogenin (Immunoglobulin superfamily DCC subclass member 2)

Entry name NEO1	UniProt ID Q92859	EVMP score 0.50
Frequency 1	Transmembrane count 1	Protein classification Cancer-related genesPlasma proteinsPredicted membrane proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Neogenin (Immunoglobulin superfamily DCC subclass member 2)

Protein Class

Cancer-related genesPlasma proteinsPredicted membrane proteins

Protein Function

Cancer-related genes:Candidate cancer biomarkers

Transmembrane

1106..1126; Helical

Transmembrane Count

Ensembl

ENSG00000067141

Entrez Gene Symbol

NEO1

Gene Synonym

HsT17534IGDCC2NGNNTN1R2

Gene Description

Neogenin 1

Chromosome

Position

73051710-73305205

Frequency

EVMP Score

0.50

Fluorescence & Localization

Tissue SpecificliverBrain Regional Specificchoroid plexusCell SpecificHepatocytesSingle-Nuclei Brain Specificchoroid plexus epithelial cell

Function & Pathway

Protein Function

Cancer-related genes:Candidate cancer biomarkers

Cellular Component

Molecular Function

Biological Process

KEGG

Reactome

Mediation Categories

Fusion and delivery mediationMetabolism mediation

Relations & Evidence

Enzyme-Mediated Modification

0 records.

Ligand-Receptor Signaling

63 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
cell_adhesion	cell_adhesion	HGNC	Yes	Yes	No	Yes	No
adhesion	adhesion	OmniPath	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No
transmembrane_predicted	transmembrane	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane	TopDB	No	No	No	Yes	No
transmembrane	transmembrane	LOCATE	No	No	No	Yes	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	Yes	No

Page 4 of 7Previous Next

Regulatory Interaction Network

6 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
NEO1	Q92859	BMP4	P12644	Yes	No	Yes	SignaLink3	SignaLink3:21149453
NEO1	Q92859	BMP2	P12643	Yes	No	Yes	HINTSignaLink3	SignaLink3:21149453 HINT:25938661 HINT:18335997
NET3	O00634	NEO1	Q92859	Yes	Yes	No	HPMRFantom5_LRdbCellTalkDBHPMR_LRdbHPRD_LRdbiTALKHPMR_CellinkertalklrRamilowski2015SIGNORconnectomeDB2020HPRDHPRD_talklrCellinkerWangLRdbSTRING_talklrHPMR_talklr	LRdb:15520228 CellTalkDB:15520228 Cellinker:15520228 HPRD:10366627 SIGNOR:28245592 connectomeDB2020:10366627 connectomeDB2020:15520228LRdb:1Cellinker:10366627 HPMR:15520228
RGMA	Q96B86	NEO1	Q92859	Yes	Yes	Yes	HPMRFantom5_LRdbCellTalkDBHPMR_LRdbiTALKHPMR_CellinkertalklrRamilowski2015SIGNORconnectomeDB2020Baccin2019Ramilowski2015_Baccin2019CellinkerWangLRdbSTRING_talklrEMBRACEHPMR_talklr	Baccin2019:15258590 connectomeDB2020:15258590 SIGNOR:18485097 LRdb:15258590 Cellinker:15258590 HPMR:15258590
NET4	Q9HB63	NEO1	Q92859	Yes	Yes	No	SIGNOR	SIGNOR:28245592
NET1	O95631	NEO1	Q92859	Yes	Yes	No	Fantom5_LRdbCellTalkDBHPRD_LRdbiTALKtalklrSIGNORconnectomeDB2020HPRDHPRD_talklrBaccin2019Ramilowski2015_Baccin2019CellinkerLRdbSTRING_talklrEMBRACERamilowski2015	Baccin2019:12636918 HPRD:12636918 CellTalkDB:8861902 HPRD:8861902LRdb:126Cellinker:8861902 Cellinker:12636918 SIGNOR:28245592 Baccin2019:8861902 connectomeDB2020:8861902 connectomeDB2020:12636918 LRdb:8861902

Protein Complex Composition

3 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
NEO1 TNF TNFRSF1A	P01375 P19438 Q92859	0:0:0	hu.MAP
BMP2 NEO1 RGMB	P12643 Q6NW40 Q92859	1:2:1	PDB	PDB:4ui2
GK NEO1	P32189 Q92859	0:0	hu.MAP2

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Ultrafiltration / Tangential Flow Filtration	Mass spectrometry	1	34063765

Sequence, Structure & Domains

Sequences

Length

1,461

Mass

160,017

Sequence

MAAERGARRLLSTPSFWLYCLLLLGRRAPGAAAARSGSAPQSPGASIRTFTPFYFLVEPVDTLSVRGSSVILNCSAYSEPSPKIEWKKDGTFLNLVSDDRRQLLPDGSLFISNVVHSKHNKPDEGYYQCVATVESLGTIISRTAKLIVAGLPRFTSQPEPSSVYAGNNAILNCEVNADLVPFVRWEQNRQPLLLDDRVIKLPSGMLVISNATEGDGGLYRCVVESGGPPKYSDEVELKVLPDPEVISDLVFLKQPSPLVRVIGQDVVLPCVASGLPTPTIKWMKNEEALDTESSERLVLLAGGSLEISDVTEDDAGTYFCIADNGNETIEAQAELTVQAQPEFLKQPTNIYAHESMDIVFECEVTGKPTPTVKWVKNGDMVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQAGAQLIILEHAPATTGPLPSAPRDVVASLVSTRFIKLTWRTPASDPHGDNLTYSVFYTKEGIARERVENTSHPGEMQVTIQNLMPATVYIFRVMAQNKHGSGESSAPLRVETQPEVQLPGPAPNLRAYAASPTSITVTWETPVSGNGEIQNYKLYYMEKGTDKEQDVDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTPDVAVRTLSDVPSAAPQNLSLEVRNSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFESDLDETRVPEVPSSLHVRPLVTSIVVSWTPPENQNIVVRGYAIGYGIGSPHAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHTDTSEVDLFVINAPYTPVPDPTPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIPANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFELVPTSPPKDVTVVSKEGKPKTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPKADSSDKMPNDQASGSGGKGSRLPDLGSDYKPPMSGSNSPHGSPTSPLDSNMLLVIIVSVGVITIVVVVIIAVFCTRRTTSHQKKKRAACKSVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPVDNSMDSNIHQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDSQPPQPVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTESVRNTPSTDTMPASSSQTCCTDHQDPEGATSSSYLASSQEEDSGQSLPTAHVRPSHPLKSFAVPAIPPPGPPTYDPALPSTPLLSQQALNHHIHSVKTASIGTLGRSRPPMPVVVPSAPEVQETTRMLEDSESSYEPDELTKEMAHLEGLMKDLNAITTA

Alternative Products

Event=Alternative splicing; Named isoforms=4; Comment=Additional isoforms seem to exist.; Name=1; IsoId=Q92859-1; Sequence=Displayed; Name=2; IsoId=Q92859-2; Sequence=VSP_002593; Name=3; IsoId=Q92859-3; Sequence=VSP_043330; Name=4; IsoId=Q92859-4; Sequence=VSP_047134

Alternative Sequence

1054..1064; Missing (in isoform 4); 1248..1301; PVISAHPIHSLDNPHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTE -> Q (in isoform 3); 1248..1300; Missing (in isoform 2)

3D Structural Models

Turn

659..661

Helix

780..782; 1002..1004

Beta Strand

443..450; 455..460; 470..479; 486..489; 496..500; 508..516; 521..524; 528..531; 546..551; 554..558; 570..578; 587..589; 591..596; 604..612; 638..643; 646..655; 666..670; 672..675; 678..683; 693..697; 704..708; 710..713; 716..720; 724..727; 743..750; 753..759; 770..775; 783..786; 793..796; 808..812; 858..864; 866..868; 870..875; 881..883; 890..897; 906..917; 925..934; 945..948; 959..966; 969..978; 989..996; 998..1000; 1005..1013; 1015..1019; 1027..1036; 1047..1050

3D Structure

NMR spectroscopy (6); X-ray crystallography (1)

Domain & Motif Annotations

Compositional Bias

1052..1061; Basic and acidic residues; 1087..1097; Polar residues; 1191..1206; Polar residues; 1289..1322; Polar residues; 1330..1349; Polar residues; 1366..1375; Pro residues

Domain (CC)

The Fibronectin repeats 5 and 6 mediate interaction with RGM family molecules.

Domain (FT)

52..141; Ig-like C2-type 1; 152..238; Ig-like C2-type 2; 243..336; Ig-like C2-type 3; 341..426; Ig-like C2-type 4; 441..535; Fibronectin type-III 1; 541..631; Fibronectin type-III 2; 636..731; Fibronectin type-III 3; 741..831; Fibronectin type-III 4; 856..952; Fibronectin type-III 5; 957..1054; Fibronectin type-III 6

Region

1041..1097; Disordered; 1138..1160; Disordered; 1174..1206; Disordered; 1235..1276; Disordered; 1289..1381; Disordered

Protein Families

Immunoglobulin superfamily
DCC family

Sequence Similarities

Belongs to the immunoglobulin superfamily. DCC family.

Clinical Relevance

Disease Involvement

Cancer-related genes

Antibody

CAB009320 HPA027804 HPA027805 HPA027806