Protein detail

BORC5

BLOC-1-related complex subunit 5 (Loss of heterozygosity 12 chromosomal region 1) (Myristoylated lysosomal protein) (Myrlysin)

Entry name BORC5	UniProt ID Q969J3	EVMP confidence score 0.50
Supporting publications (n) 1	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

BLOC-1-related complex subunit 5 (Loss of heterozygosity 12 chromosomal region 1) (Myristoylated lysosomal protein) (Myrlysin)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000165714

Entrez Gene Symbol

BORCS5

Gene Synonym (2)

LOH12CR1LOH1CR12

Gene Description

BLOC-1 related complex subunit 5

Chromosome

Position

12357078-12471233

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization3

Tissue Specificadrenal glandCell SpecificAdrenal medulla cellsSingle-Nuclei Brain Specificlower rhombic lip

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (7)

Molecular Function

GO:0005515 protein binding

Biological Process (3)

KEGG

hsa04142 Lysosome biogenesis

Mediation Categories

Fusion and delivery mediation

Relations & Evidence13

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (8)

8 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
BORC complex	BLOC1S1 BLOC1S2 BORCS5 BORCS6 BORCS7 BORCS8 KXD1 SNAPIN	O95295 P78537 Q6QNY1 Q969J3 Q96B45 Q96FH0 Q96GS4 Q9BQD3	1:1:1:1:1:1:1:1	KEGG-MEDICUSCORUMComplexPortal	CORUM:7545	14755292 25898167
HT_DM_Cluster138	BLOC1S2 BORCS5 DBNDD1 DBNDD2 DTNBP1 SNAPIN	O95295 Q6QNY1 Q969J3 Q96EV8 Q9BQY9 Q9H9R9	1:1:1:1:1:1	Compleat	Compleat:HC860	22036573
	BORCS5 BORCS6 BORCS7 BORCS8 CCDC122 CCDC172 CCDC57 LAMTOR1 LAMTOR2 LAMTOR3 LAMTOR4 LAMTOR5 ODF2L TEX35 TRIM37 ZNF610	O43504 O94972 P0C7W6 Q0VGL1 Q2TAC2 Q5T0J7 Q5T0U0 Q6IAA8 Q8N9Z0 Q969J3 Q96B45 Q96FH0 Q96GS4 Q9UHA4 Q9ULJ1 Q9Y2Q5	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP2
	BORCS5 BORCS6 BORCS7 BORCS8 CCDC122 CCDC57 DISC1 KXD1 LAMTOR3 ODF2L SCLT1 TRIM37	O94972 Q2TAC2 Q5T0U0 Q969J3 Q96B45 Q96FH0 Q96GS4 Q96NL6 Q9BQD3 Q9NRI5 Q9UHA4 Q9ULJ1	0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP
	BLOC1S1 BLOC1S2 BLOC1S4 BLOC1S5 BLOC1S6 BORCS5 DTNBP1 LAMC2 SNAPIN TXLNB	O95295 P78537 Q13753 Q6QNY1 Q8N3L3 Q8TDH9 Q969J3 Q96EV8 Q9NUP1 Q9UL45	0:0:0:0:0:0:0:0:0:0	hu.MAP
	BLOC1S1 BORCS5	P78537 Q969J3	0:0	hu.MAP
	BORCS5 BORCS6 CCDC57 LAMTOR2 ODF2L	Q2TAC2 Q969J3 Q96GS4 Q9ULJ1 Q9Y2Q5	0:0:0:0:0	hu.MAP2
	BORCS5 BORCS7 TEX35	Q5T0J7 Q969J3 Q96B45	0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Polymer Precipitation	Western blotting	1	38731868

Sequence, Structure & Domains9

Sequences

Length

196

Mass

22,222

Sequence

MGSEQSSEAESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAKLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPDRELRL

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q969J3-1; Sequence=Displayed; Name=2; IsoId=Q969J3-2; Sequence=VSP_031254

Alternative Sequence

20..67; Missing (in isoform 2)

Domain & Motif Annotations

Compositional Bias

1..22; Polar residues

Region

1..32; Disordered

Protein Families

BORCS5 family

Sequence Similarities

Belongs to the BORCS5 family.

Clinical Relevance4

Antibody (2)

HPA039509 HPA043627

Interaction Protein (2)

ENSG00000166275ENSG00000179950

Interaction Count

Interaction Dataset (2)

biogrid_bioplexintact_biogrid

Supporting Publications1

PMID	Title	Abstract
30550287	Label-Free Proteomic Analysis of Exosomes Secreted from THP-1-Derived Macrophages Treated with IFN-α Identifies Antiviral Proteins Enriched in Exosomes.	No abstract available