Protein detail

ESAM

Endothelial cell-selective adhesion molecule

Entry name ESAM	UniProt ID Q96AP7	EVMP confidence score 0.25
Supporting publications (n) 3	Transmembrane count 1	Protein classification Plasma proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information12

Protein Names

Endothelial cell-selective adhesion molecule

Protein Class (2)

Plasma proteinsPredicted membrane proteins

Transmembrane

249..269; Helical

Transmembrane Count

Ensembl

ENSG00000149564

Entrez Gene Symbol

ESAM

Gene Synonym

W117m

Gene Description

Endothelial cell adhesion molecule

Chromosome

Position

124752583-124762290

Supporting publications (n)

EVMP confidence score

0.25

Fluorescence & Localization7

Tissue SpecificbrainCell SpecificTuft cellsSingle-Nuclei Brain SpecificastrocyteBlood Cell SpecificbasophilSecretome LocationIntracellular and membraneSecretome FunctionReceptor

Function & Pathway6

Cellular Component (5)

Molecular Function (2)

Biological Process (3)

KEGG (3)

Reactome (2)

Mediation Categories (3)

Adhesion and uptake mediationFusion and delivery mediationImmune mediation

Relations & Evidence39

Ligand-Receptor Signaling (38)

38 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
cell_surface	cell_surface	Baccin2019	No	No	No	Yes	No
cell_surface	cell_surface	OmniPath	No	No	No	Yes	No
ligand	ligand	ICELLNET	Yes	No	No	Yes	No
cell_adhesion	ligand	ICELLNET	Yes	No	No	Yes	No
ligand	ligand	OmniPath	Yes	No	No	Yes	No
transmembrane	transmembrane_predicted	Phobius	No	No	No	Yes	No
transmembrane_phobius	transmembrane_predicted	Almen2009	No	No	No	Yes	No
transmembrane_tmhmm	transmembrane_predicted	Almen2009	No	No	No	Yes	No

Page 4 of 4Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	ELISA	2	38113368 37322475

Sequence, Structure & Domains8

Sequences

Length

390

Mass

41,176

Sequence

MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q96AP7-1; Sequence=Displayed; Name=2; IsoId=Q96AP7-2; Sequence=VSP_055594, VSP_055595, VSP_055596

Alternative Sequence

22..200; Missing (in isoform 2); 287..320; EDAIAPRTLPWPKSSDTISKNGTLSSVTSARALR -> VRSPLGLSFSAPKMEWLWKWRDAHFYRDSYLSKW (in isoform 2); 321..390; Missing (in isoform 2)

Domain & Motif Annotations

Compositional Bias

333..342; Polar residues

Domain (FT)

30..143; Ig-like V-type; 153..242; Ig-like C2-type

Region

316..368; Disordered

Clinical Relevance2

Disease Involvement (2)

Disease variantIntellectual disability

Antibody (2)

HPA056293 HPA072563

Supporting Publications3

PMID	Title	Abstract
30915084	Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton.	No abstract available
37670049	Proteomic and functional characterisation of extracellular vesicles from collagen VI deficient human fibroblasts reveals a role in cell motility.	No abstract available
38014595	Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia.	No abstract available