Protein detail
CLD23
Claudin-23
Entry name CLD23 | UniProt ID | EVMP confidence score 0.60 |
Supporting publications (n) 12 | Transmembrane count 4 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Claudin-23
Protein Function
Transporters:Transporter channels and pores
Transmembrane
4..24; Helical; 82..102; Helical; 111..131; Helical; 161..181; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Supporting publications (n)
12
EVMP confidence score
0.60
Fluorescence & Localization2
Tissue SpecificbrainCell SpecificAdrenal medulla cells
Function & Pathway7
Protein Function
Transporters:Transporter channels and pores
Cellular Component (2)
Molecular Function (3)
Biological Process (3)
KEGG (7)
Reactome (3)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence14
Ligand-Receptor Signaling (13)
13 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
Page 2 of 2Previous
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 38716512 |
Sequence, Structure & Domains7
Sequences
Length
292
Mass
31,915
Sequence
MRTPVVMTLGMVLAPCGLLLNLTGTLAPGWRLVKGFLNQPVDVELYQGLWDMCREQSSRERECGQTDQWGYFEAQPVLVARALMVTSLAATVLGLLLASLGVRCWQDEPNFVLAGLSGVVLFVAGLLGLIPVSWYNHFLGDRDVLPAPASPVTVQVSYSLVLGYLGSCLLLLGGFSLALSFAPWCDERCRRRRKGPSAGPRRSSVSTIQVEWPEPDLAPAIKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTHPCDSSLPCDSDL
Domain & Motif Annotations
Compositional Bias
273..282; Polar residues
Region
222..292; Disordered
Protein Families
Claudin family
Sequence Similarities
Belongs to the claudin family.
Supporting Publications12
| PMID | Title | Abstract |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No abstract available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No abstract available |
| 32089743 | Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism. | No abstract available |
| 33035814 | Knockout of PRDX6 induces mitochondrial dysfunction and cell cycle arrest at G2/M in HepG2 hepatocarcinoma cells. | No abstract available |
| 34186243 | A Reductionist Approach Using Primary and Metastatic Cell-Derived Extracellular Vesicles Reveals Hub Proteins Associated with Oral Cancer Prognosis. | No abstract available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No abstract available |
| 36398564 | Differential ultracentrifugation enables deep plasma proteomics through enrichment of extracellular vesicles. | No abstract available |
| 37702715 | One-Pot Analytical Pipeline for Efficient and Sensitive Proteomic Analysis of Extracellular Vesicles. | No abstract available |
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No abstract available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No abstract available |
Page 1 of 2Next