Protein detail
TM101
Transmembrane protein 101 (Putative NF-kappa-B-activating protein 130)
Entry name TM101 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 2 | Transmembrane count 8 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Transmembrane protein 101 (Putative NF-kappa-B-activating protein 130)
Protein Function (2)
- Transporters
- Predicted intracellular proteins
Transmembrane
21..40; Helical; 52..72; Helical; 77..97; Helical; 110..130; Helical; 139..159; Helical; 182..202; Helical; 206..226; Helical; 233..253; Helical
Transmembrane Count
8
Ensembl
Entrez Gene Symbol
Supporting publications (n)
2
EVMP confidence score
0.50
Fluorescence & Localization2
Cell SpecificMegakaryocytesSingle-Nuclei Brain Specificcentral nervous system macrophage
Function & Pathway5
Protein Function (2)
- Transporters
- Predicted intracellular proteins
Cellular Component (2)
Molecular Function
Biological Process (3)
Mediation Categories (2)
Immune mediationReceptor-signaling mediation
Relations & Evidence10
Ligand-Receptor Signaling (9)
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry | 0 |
Sequence, Structure & Domains3
Sequences
Length
257
Mass
28,795
Sequence
MASKIGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMGAAVLCASFMSFGVKRRWFALGAALQLAISTYAAYIGGYVHYGDWLKVRMYSRTVAIIGGFLVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAYSLQHSKEDRLAYLNHLPGGELMIQLFFVLYGILALAFLSGYYVTLAAQILAVLLPPVMLLIDGNVAYWHNTRRVEFWNQMKLLGESVGIFGTAVILATDG
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 31508500 | Proteomic profiling of extracellular vesicles allows for human breast cancer subtyping. | No abstract available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |