Protein detail

VPS50

Syndetin (Coiled-coil domain-containing protein 132) (EARP/GARPII complex subunit VPS50)

Entry name VPS50	UniProt ID Q96JG6	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Disease related genesPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Syndetin (Coiled-coil domain-containing protein 132) (EARP/GARPII complex subunit VPS50)

Protein Class (2)

Disease related genesPredicted intracellular proteins

Protein Function (2)

Disease related genes
Predicted intracellular proteins

Ensembl

ENSG00000004766

Entrez Gene Symbol

VPS50

Gene Synonym (5)

CCDC132DKFZp313I2429FLJ20097KIAA1861VPS54L

Gene Description

VPS50 subunit of EARP/GARPII complex

Chromosome

Position

93232340-93361123

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization1

Function & Pathway6

Protein Function (2)

Disease related genes
Predicted intracellular proteins

Cellular Component (5)

Molecular Function (2)

Biological Process (3)

Canonical Pathways (3)

M266 Pid ncadherin pathway
M161 Pid ifng pathway
M10 Pid bcr 5pathway

Mediation Categories

Fusion and delivery mediation

Relations & Evidence12

Ligand-Receptor Signaling (6)

6 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No

Protein Complex Composition (5)

5 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
EARP complex	VPS50 VPS51 VPS52 VPS53	Q5VIR6 Q8N1B4 Q96JG6 Q9UID3	1:1:1:1	CORUMComplexPortal	CORUM:6459	14755292 25799061
	CRABP2 DHH EIPR1 PPFIBP2 SNAP29 TRAF3 VPS50 VPS51 VPS52 VPS53 VPS54	O43323 O95721 P29373 Q13114 Q53HC9 Q5VIR6 Q8N1B4 Q8ND30 Q96JG6 Q9P1Q0 Q9UID3	0:0:0:0:0:0:0:0:0:0:0	hu.MAP2
	CRABP2 DHH EIPR1 PPFIBP2 SNAP29 VPS50 VPS51 VPS52 VPS53 VPS54	O43323 O95721 P29373 Q53HC9 Q5VIR6 Q8N1B4 Q8ND30 Q96JG6 Q9P1Q0 Q9UID3	0:0:0:0:0:0:0:0:0:0	hu.MAP2
	CRABP2 EIPR1 VPS50 VPS51 VPS52 VPS53 VPS54	P29373 Q53HC9 Q5VIR6 Q8N1B4 Q96JG6 Q9P1Q0 Q9UID3	0:0:0:0:0:0:0	hu.MAP2
	EIPR1 VPS50 VPS51 VPS52 VPS53 VPS54	Q53HC9 Q5VIR6 Q8N1B4 Q96JG6 Q9P1Q0 Q9UID3	0:0:0:0:0:0	hu.MAPhu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Polymer Precipitation	Western blotting	1	38731868

Sequence, Structure & Domains10

Sequences

Length

964

Mass

111,174

Sequence

MQKIKSLMTRQGLKSPQESLSDLGAIESLRVPGKEEFRELREQPSDPQAEQELINSIEQVYFSVDSFDIVKYELEKLPPVLNLQELEAYRDKLKQQQAAVSKKVADLILEKQPAYVKELERVTSLQTGLQLAAVICTNGRRHLNIAKEGFTQASLGLLANQRKRQLLIGLLKSLRTIKTLQRTDVRLSEMLEEEDYPGAIQLCLECQKAASTFKHYSCISELNSKLQDTLEQIEEQLDVALSKICKNFDINHYTKVQQAYRLLGKTQTAMDQLHMHFTQAIHNTVFQVVLGYVELCAGNTDTKFQKLQYKDLCTHVTPDSYIPCLADLCKALWEVMLSYYRTMEWHEKHDNEDTASASEGSNMIGTEETNFDRGYIKKKLEHGLTRIWQDVQLKVKTYLLGTDLSIFKYDDFIFVLDIISRLMQVGEEFCGSKSEVLQESIRKQSVNYFKNYHRTRLDELRMFLENETWELCPVKSNFSILQLHEFKFMEQSRSPSVSPSKQPVSTSSKTVTLFEQYCSGGNPFEIQANHKDEETEDVLASNGYESDEQEKSAYQEYDSDSDVPEELKRDYVDEQTGDGPVKSVSRETLKSRKKSDYSLNKVNAPILTNTTLNVIRLVGKYMQMMNILKPIAFDVIHFMSQLFDYYLYAIYTFFGRNDSLESTGLGLSSSRLRTTLNRIQESLIDLEVSADPTATLTAAEERKEKVPSPHLSHLVVLTSGDTLYGLAERVVATESLVFLAEQFEFLQPHLDAVMPAVKKPFLQQFYSQTVSTASELRKPIYWIVAGKALDYEQMLLLMANVKWDVKEIMSQHNIYVDALLKEFEQFNRRLNEVSKRVRIPLPVSNILWEHCIRLANRTIVEGYANVKKCSNEGRALMQLDFQQFLMKLEKLTDIRPIPDKEFVETYIKAYYLTENDMERWIKEHREYSTKQLTNLVNVCLGSHINKKARQKLLAAIDDIDRPKR

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q96JG6-1; Sequence=Displayed; Name=2; IsoId=Q96JG6-2; Sequence=VSP_028658, VSP_028659; Name=3; IsoId=Q96JG6-3; Sequence=VSP_045572

Alternative Sequence

1..34; MQKIKSLMTRQGLKSPQESLSDLGAIESLRVPGK -> MLTL (in isoform 3); 315..327; HVTPDSYIPCLAD -> VCSDLITIHISLL (in isoform 2); 328..964; Missing (in isoform 2)

Domain & Motif Annotations

Compositional Bias

8..20; Polar residues

Coiled Coil

82..105; 216..244

Region

1..25; Disordered; 542..564; Disordered

Protein Families

Syndetin family

Sequence Similarities

Belongs to the syndetin family.

Clinical Relevance5

Disease Involvement (3)

EpilepsyIntellectual disabilityIntrahepatic cholestasis

Antibody

HPA026679

Interaction Protein (4)

ENSG00000032389ENSG00000141252ENSG00000149823ENSG00000223501

Interaction Count

Interaction Dataset (2)

intact_biogrid_bioplexintact_biogrid

Supporting Publications1

PMID	Title	Abstract
37285022	siRNA screening reveals that SNAP29 contributes to exosome release.	Immunoblotting analysis of small EVs showed that the release of several proteins considered to be associated with exosomes like syntenin, CD63 and Tsg101 was reduced, while the level of several proteins that have been shown to be released in ectosomes (annexins) or by secretory autophagy (LC3B and p62) was not affected by SNAP29 depletion.