Protein detail
CANB2
Calcineurin subunit B type 2 (Calcineurin B-like protein) (CBLP) (Calcineurin BII) (CNBII) (PPP3R1-like) (Protein phosphatase 2B regulatory subunit 2) (Protein phosphatase 3 regulatory subunit B beta isoform)
Entry name CANB2 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 2 | Transmembrane count | Protein classification FDA approved drug targetsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Calcineurin subunit B type 2 (Calcineurin B-like protein) (CBLP) (Calcineurin BII) (CNBII) (PPP3R1-like) (Protein phosphatase 2B regulatory subunit 2) (Protein phosphatase 3 regulatory subunit B beta isoform)
Protein Class (2)
FDA approved drug targetsPredicted intracellular proteins
Protein Function (2)
- FDA approved drug targets:Small molecule drugs
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
PPP3RL
Gene Description
Protein phosphatase 3 regulatory subunit B, beta
Chromosome
9
Position
101591604-101595021
Supporting publications (n)
2
EVMP confidence score
0.38
Fluorescence & Localization1
Cell SpecificPodocytes
Function & Pathway6
Protein Function (2)
- FDA approved drug targets:Small molecule drugs
- Predicted intracellular proteins
Cellular Component (5)
Molecular Function (4)
Biological Process (3)
KEGG (32)
- hsa04010 MAPK signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04114 Oocyte meiosis
- KEGG:hsa04218 Cellular senescence
- KEGG:hsa04310 Wnt signaling pathway
- KEGG:hsa04360 Axon guidance
- KEGG:hsa04370 VEGF signaling pathway
- KEGG:hsa04380 Osteoclast differentiation
- KEGG:hsa04625 C-type lectin receptor signaling pathway
Page 1 of 4
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence11
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Protein Complex Composition (6)
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Calcineurin-Calmodulin complexalpha-R2 variant | CALM2PPP3CAPPP3R2 | P0DP24Q08209Q96LZ3 | 1:1:1 | ComplexPortal | PDB:2r28PDB:4q5uPDB:2jziintact:EBI-13919840PDB:2w73 | 27597899223437221764052719404396863190418384083157576469660947182964421112394314755292110156192514486822688515 |
| Calcineurin-Calmodulin complexbeta-R2 variant | CALM2PPP3CBPPP3R2 | P0DP24P16298Q96LZ3 | 1:1:1 | ComplexPortal | intact:EBI-13638922 | 27597899223437221764052796609471829644215757646111239431475529211015619863190422688515 |
| Calcineurin-Calmodulin complexgamma-R2 variant | CALM2PPP3CCPPP3R2 | P0DP24P48454Q96LZ3 | 1:1:1 | ComplexPortal | intact:EBI-13920618 | 27597899223437221764052796609471829644215757646111239431475529211015619863190422688515 |
| PPP3CBPPP3R2 | P16298Q96LZ3 | 0:0 | KEGG-MEDICUS | |||
| PPP3CCPPP3R2 | P48454Q96LZ3 | 0:0 | KEGG-MEDICUS | |||
| PPP3CAPPP3R2 | Q08209Q96LZ3 | 0:0 | KEGG-MEDICUS |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationMicrofluidics-Based Methods | Mass spectrometry | 1 | 41167904 |
Sequence, Structure & Domains7
Sequences
Length
170
Mass
19,533
Sequence
MGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
Domain & Motif Annotations
Domain (FT)
18..46; EF-hand 1; 50..85; EF-hand 2; 87..122; EF-hand 3; 128..163; EF-hand 4
Region
131..136; Calcineurin A binding
Protein Families
Calcineurin regulatory subunit family
Sequence Similarities
Belongs to the calcineurin regulatory subunit family.
Clinical Relevance4
Disease Involvement
FDA approved drug targets
Drug Targets
FDA approved drug targets
Drugs
Antibody
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 36398564 | Differential ultracentrifugation enables deep plasma proteomics through enrichment of extracellular vesicles. | No abstract available |
| 39569406 | Proteomics of circulating extracellular vesicles reveals diverse clinical presentations of COVID-19 but fails to identify viral peptides. | No abstract available |