Protein detail
CANB2
Calcineurin subunit B type 2 (Calcineurin B-like protein) (CBLP) (Calcineurin BII) (CNBII) (PPP3R1-like) (Protein phosphatase 2B regulatory subunit 2) (Protein phosphatase 3 regulatory subunit B beta isoform)
Entry name CANB2 | UniProt ID | EVMP score 0.38 |
Frequency 2 | Transmembrane count | Protein classification FDA approved drug targetsPredicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Calcineurin subunit B type 2 (Calcineurin B-like protein) (CBLP) (Calcineurin BII) (CNBII) (PPP3R1-like) (Protein phosphatase 2B regulatory subunit 2) (Protein phosphatase 3 regulatory subunit B beta isoform)
Protein Class
FDA approved drug targetsPredicted intracellular proteins
Protein Function
- FDA approved drug targets:Small molecule drugs
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
PPP3RL
Gene Description
Protein phosphatase 3 regulatory subunit B, beta
Chromosome
9
Position
101591604-101595021
Frequency
2
EVMP Score
0.38
Fluorescence & Localization
Cell SpecificPodocytes
Function & Pathway
Protein Function
- FDA approved drug targets:Small molecule drugs
- Predicted intracellular proteins
Cellular Component
Molecular Function
Biological Process
KEGG
- hsa04010 MAPK signaling pathway
- KEGG:hsa04020 Calcium signaling pathway
- KEGG:hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04114 Oocyte meiosis
- KEGG:hsa04218 Cellular senescence
- KEGG:hsa04310 Wnt signaling pathway
- KEGG:hsa04360 Axon guidance
- KEGG:hsa04370 VEGF signaling pathway
- KEGG:hsa04380 Osteoclast differentiation
- KEGG:hsa04625 C-type lectin receptor signaling pathway
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa04660 T cell receptor signaling pathway
- KEGG:hsa04662 B cell receptor signaling pathway
- KEGG:hsa04720 Long-term potentiation
- KEGG:hsa04724 Glutamatergic synapse
- KEGG:hsa04921 Oxytocin signaling pathway
- KEGG:hsa04922 Glucagon signaling pathway
- KEGG:hsa04924 Renin secretion
- KEGG:hsa05010 Alzheimer disease
- KEGG:hsa05014 Amyotrophic lateral sclerosis
- KEGG:hsa05020 Prion disease
- KEGG:hsa05022 Pathways of neurodegeneration - multiple diseases
- KEGG:hsa05031 Amphetamine addiction
- KEGG:hsa05152 Tuberculosis
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05166 Human T-cell leukemia virus 1 infection
- KEGG:hsa05167 Kaposi sarcoma-associated herpesvirus infection
- KEGG:hsa05170 Human immunodeficiency virus 1 infection
- KEGG:hsa05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
- KEGG:hsa05417 Lipid and atherosclerosis
Mediation Categories
Clinical-translation mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Calcineurin-Calmodulin complexalpha-R2 variant | CALM2PPP3CAPPP3R2 | P0DP24Q08209Q96LZ3 | 1:1:1 | ComplexPortal | PDB:2r28PDB:4q5uPDB:2jziintact:EBI-13919840PDB:2w73 | 27597899223437221764052719404396863190418384083157576469660947182964421112394314755292110156192514486822688515 |
| Calcineurin-Calmodulin complexbeta-R2 variant | CALM2PPP3CBPPP3R2 | P0DP24P16298Q96LZ3 | 1:1:1 | ComplexPortal | intact:EBI-13638922 | 27597899223437221764052796609471829644215757646111239431475529211015619863190422688515 |
| Calcineurin-Calmodulin complexgamma-R2 variant | CALM2PPP3CCPPP3R2 | P0DP24P48454Q96LZ3 | 1:1:1 | ComplexPortal | intact:EBI-13920618 | 27597899223437221764052796609471829644215757646111239431475529211015619863190422688515 |
| PPP3CBPPP3R2 | P16298Q96LZ3 | 0:0 | KEGG-MEDICUS | |||
| PPP3CCPPP3R2 | P48454Q96LZ3 | 0:0 | KEGG-MEDICUS | |||
| PPP3CAPPP3R2 | Q08209Q96LZ3 | 0:0 | KEGG-MEDICUS |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationMicrofluidics-Based Methods | Mass spectrometry | 1 | 41167904 |
Sequence, Structure & Domains
Sequences
Length
170
Mass
19,533
Sequence
MGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRRVIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
3D Structural Models
Domain & Motif Annotations
Domain (FT)
18..46; EF-hand 1; 50..85; EF-hand 2; 87..122; EF-hand 3; 128..163; EF-hand 4
Region
131..136; Calcineurin A binding
Protein Families
Calcineurin regulatory subunit family
Sequence Similarities
Belongs to the calcineurin regulatory subunit family.
Clinical Relevance
Disease Involvement
FDA approved drug targets
Drug Targets
FDA approved drug targets
Drugs
Antibody