Protein detail
DCBD2
Discoidin, CUB and LCCL domain-containing protein 2 (CUB, LCCL and coagulation factor V/VIII-homology domains protein 1) (Endothelial and smooth muscle cell-derived neuropilin-like protein)
Entry name DCBD2 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Predicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Discoidin, CUB and LCCL domain-containing protein 2 (CUB, LCCL and coagulation factor V/VIII-homology domains protein 1) (Endothelial and smooth muscle cell-derived neuropilin-like protein)
Protein Class (2)
Predicted intracellular proteinsPredicted membrane proteins
Protein Function
Predicted intracellular proteins
Transmembrane
529..549; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CLCP1ESDN
Gene Description
Discoidin, CUB and LCCL domain containing 2
Chromosome
3
Position
98795941-98901695
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificlymphoid tissueCell SpecificPlateletsSingle-Nuclei Brain SpecificfibroblastBlood Cell SpecificgdT-cellBlood Lineage SpecificNK-cells
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (2)
Molecular Function (2)
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence73
Enzyme-Mediated Modification (33)
33 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| DCBLD2 | FYN | P06241 | Y | 715 | phosphorylation | PhosphoSite | |
| DCBLD2 | FYN | P06241 | Y | 565 | phosphorylation | PhosphoSite | |
| DCBLD2 | FYN | P06241 | S | 657 | phosphorylation | PhosphoSite | |
| DCBLD2 | FYN | P06241 | Y | 569 | phosphorylation | PhosphoSite | |
| DCBLD2 | FYN | P06241 | Y | 655 | phosphorylation | PhosphoSite | |
| DCBLD2 | FYN | P06241 | Y | 649 | phosphorylation | PhosphoSite | |
| DCBLD2 | FYN | P06241 | Y | 621 | phosphorylation | PhosphoSite | |
| DCBLD2 | FYN | P06241 | Y | 732 | phosphorylation | PhosphoSite | |
| DCBLD2 | FYN | P06241 | Y | 677 | phosphorylation | PhosphoSite | |
| DCBLD2 | FYN | P06241 | S | 618 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling (37)
37 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | GO_Intercell | Yes | Yes | |||
| receptor | receptor | ICELLNET | Yes | Yes | |||
| receptor | receptor | CellTalkDB | Yes | Yes | |||
| receptor | receptor | Ramilowski2015 | Yes | Yes | |||
| receptor | receptor | LRdb | Yes | Yes | |||
| receptor | receptor | Baccin2019 | Yes | Yes | |||
| semaphorin | receptor | ICELLNET | Yes | Yes | |||
| receptor | receptor | OmniPath | Yes | Yes | |||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes |
Page 1 of 4Next
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| FYN | P06241 | DCBD2 | Q96PD2 | Yes | Yes | PhosphoSite_norefSIGNORPhosphoSite_ProtMapperProtMapper | SIGNOR:23770091 | |
| ABL1 | P00519 | DCBD2 | Q96PD2 | Yes | PhosphoSite_norefPhosphoSitePhosphoSite_ProtMapperProtMapper | PhosphoSite:32606017PhosphoSite:23770091 |
Sequence, Structure & Domains
Sequences
Length
775
Mass
85,035
Sequence
MASRAVVRARRCPQCPQVRAAAAAPAWAALPLSRSLPPCSNSSSFSMPLFLLLLLVLLLLLEDAGAQQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNEITLLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPKKARLKKPGPPWAAFATDEYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRILYSDDGQKWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPPRNSNDLKNTTAPPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTASPDIRNTTVTPNVTKDVALAAVLVPVLVMVLTTLILILVCAWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTSTFKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVYQVPQSTQEVSGAGRDGECDVFKEIL
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q96PD2-1; Sequence=Displayed; Name=2; IsoId=Q96PD2-2; Sequence=VSP_010715
Alternative Sequence
574; G -> GFYLMVSLACRHNEG (in isoform 2)
Domain & Motif Annotations
Compositional Bias
468..477; Polar residues; 491..517; Polar residues; 690..706; Polar residues
Domain (FT)
72..186; CUB; 187..285; LCCL; 292..449; F5/8 type C
Region
454..517; Disordered; 690..710; Disordered
Clinical Relevance
Antibody
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 38716512 | Assessment of urine sample collection and processing variables for extracellular vesicle-based proteomics. | No related sentences available |