Protein detail

KLHL5

Kelch-like protein 5

Entry name KLHL5	UniProt ID Q96PQ7	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information10

Protein Names

Kelch-like protein 5

Protein Class (2)

Plasma proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000109790

Entrez Gene Symbol

KLHL5

Gene Description

Kelch like family member 5

Chromosome

Position

39045039-39126857

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization2

Cell SpecificOligodendrocytes

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (4)

Molecular Function (4)

Biological Process (3)

Reactome (5)

Mediation Categories (2)

Immune mediationMetabolism mediation

Relations & Evidence11

Ligand-Receptor Signaling (9)

9 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
transmembrane_predicted	transmembrane	OmniPath	No	No	No	No	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No
transmembrane_sosui	transmembrane_predicted	Almen2009	No	No	No	No	No
transmembrane_tmhmm	transmembrane_predicted	Almen2009	No	No	No	No	No

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
CRL3 E3 ubiquitin ligase complexKLHL5 variant	CUL3 KLHL5 RBX1	P62877 Q13618 Q96PQ7	2:2:2	ComplexPortal	intact:EBI-44455107	35580799 29249570 24959344 34838542 14755292 31652307

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	R SequencingMass spectrometry	1	39940641

Sequence, Structure & Domains9

Sequences

Length

755

Mass

84,457

Sequence

MNVIYFPLHIFVVYSRAYTSLVLVGCTNLCAVLFARCLDDHLVSLRMSGSRKEFDVKQILKIRWRWFGHQASSPNSTVDSQQGEFWNRGQTGANGGRKFLDPCSLQLPLASIGYRRSSQLDFQNSPSWPMASTSEVPAFEFTAEDCGGAHWLDRPEVDDGTSEEENESDSSSCRTSNSSQTLSSCHTMEPCTSDEFFQALNHAEQTFKKMENYLRHKQLCDVILVAGDRRIPAHRLVLSSVSDYFAAMFTNDVREARQEEIKMEGVEPNSLWSLIQYAYTGRLELKEDNIECLLSTACLLQLSQVVEACCKFLMKQLHPSNCLGIRSFADAQGCTDLHKVAHNYTMEHFMEVIRNQEFVLLPASEIAKLLASDDMNIPNEETILNALLTWVRHDLEQRRKDLSKLLAYIRLPLLAPQFLADMENNVLFRDDIECQKLIMEAMKYHLLPERRPMLQSPRTKPRKSTVGTLFAVGGMDSTKGATSIEKYDLRTNMWTPVANMNGRRLQFGVAVLDDKLYVVGGRDGLKTLNTVECYNPKTKTWSVMPPMSTHRHGLGVAVLEGPMYAVGGHDGWSYLNTVERWDPQARQWNFVATMSTPRSTVGVAVLSGKLYAVGGRDGSSCLKSVECFDPHTNKWTLCAQMSKRRGGVGVTTWNGLLYAIGGHDAPASNLTSRLSDCVERYDPKTDMWTAVASMSISRDAVGVCLLGDKLYAVGGYDGQAYLNTVEAYDPQTNEWTQVAPLCLGRAGACVVTVKL

Alternative Products

Event=Alternative splicing; Named isoforms=6; Name=1; Synonyms=KLHL5a; IsoId=Q96PQ7-1; Sequence=Displayed; Name=2; IsoId=Q96PQ7-2; Sequence=VSP_008619; Name=3; IsoId=Q96PQ7-3; Sequence=VSP_008620; Name=4; Synonyms=KLHL5b; IsoId=Q96PQ7-4; Sequence=VSP_045227; Name=5; IsoId=Q96PQ7-5; Sequence=VSP_047111; Name=6; IsoId=Q96PQ7-6; Sequence=VSP_047112

Alternative Sequence

1..187; Missing (in isoform 5); 1..46; Missing (in isoform 6); 174..234; Missing (in isoform 4); 739..755; APLCLGRAGACVVTVKL -> WHSCFIITLTLFLLKQFLW (in isoform 2); 739..755; APLCLGRAGACVVTVKL -> FSHTFEDSKDHLVAIKQTIWRQNSLSEEFRSH (in isoform 3)

Domain & Motif Annotations

Compositional Bias

158..168; Acidic residues; 169..184; Low complexity

Repeat

468..514; Kelch 1; 515..561; Kelch 2; 563..608; Kelch 3; 609..655; Kelch 4; 657..708; Kelch 5; 709..754; Kelch 6

Domain (FT)

220..287; BTB

Region

152..184; Disordered

Clinical Relevance4

Antibody (2)

HPA013958 HPA079699

Interaction Protein

ENSG00000036257

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications1

PMID	Title	Abstract
32384937	Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles.	No abstract available