Protein detail

TM237

Transmembrane protein 237 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein)

Entry name TM237	UniProt ID Q96Q45	EVMP score 0.50
Frequency 1	Transmembrane count 4	Protein classification Disease related genesHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Transmembrane protein 237 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein)

Protein Class

Disease related genesHuman disease related genesPotential drug targetsPredicted membrane proteinsTransporters

Protein Function

Disease related genes
Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
Transporters:Accessory Factors Involved in Transport
Potential drug targets

Transmembrane

227..247; Helical; 268..288; Helical; 303..323; Helical; 358..378; Helical

Transmembrane Count

Ensembl

ENSG00000155755

Entrez Gene Symbol

TMEM237

Gene Synonym

ALS2CR4JBTS14

Gene Description

Transmembrane protein 237

Chromosome

Position

201620184-201643570

Frequency

EVMP Score

0.50

Fluorescence & Localization

Function & Pathway

Protein Function

Disease related genes
Human disease related genes:Congenital malformations:Congenital malformations of the nervous system
Transporters:Accessory Factors Involved in Transport
Potential drug targets

Cellular Component

Molecular Function

GO:0005515 protein binding

Biological Process

Canonical Pathways

M60 Pid nfat tfpathway

Mediation Categories

Receptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

0 records.

Ligand-Receptor Signaling

9 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No
transmembrane	transmembrane	UniProt_location	No	No	No	No	No
transmembrane	transmembrane	UniProt_topology	No	No	No	No	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	No	No
transmembrane	transmembrane	LOCATE	No	No	No	No	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	No	No
transmembrane	transmembrane	OmniPath	No	No	No	No	No
transmembrane	transmembrane_predicted	Phobius	No	No	No	No	No

Regulatory Interaction Network

0 records.

Protein Complex Composition

5 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	References
MKS transition zone complex	AHI1 B9D1 B9D2 CC2D2A MKS1 TCTN1 TCTN2 TCTN3 TMEM107 TMEM17 TMEM216 TMEM231 TMEM237 TMEM67	Q2MV58 Q5HYA8 Q6NUS6 Q6UX40 Q86X19 Q8N157 Q96GX1 Q96Q45 Q9BPU9 Q9H6L2 Q9NXB0 Q9P0N5 Q9P2K1 Q9UPM9	1:1:1:1:1:1:1:1:1:1:1:1:1:1	ComplexPortal	28401750 14755292 22179047 32726168
	BPIFB1 EPX JCHAIN PIGR TMEM237	P01591 P01833 P11678 Q8TDL5 Q96Q45	0:0:0:0:0	hu.MAP2
	BPIFB1 EPX JCHAIN TMEM237	P01591 P11678 Q8TDL5 Q96Q45	0:0:0:0	hu.MAP2
	BPIFA1 BPIFB1 EPX TMEM237	P11678 Q8TDL5 Q96Q45 Q9NP55	0:0:0:0	hu.MAP
	EPX TMEM237	P11678 Q96Q45	0:0	hu.MAP2

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Size Exclusion Chromatography	Mass spectrometryR Sequencing	1	34265469

Sequence, Structure & Domains

Sequences

Length

408

Mass

45,526

Sequence

MRTDSGARLEEGHLRPPRALPPVPSQDDIPLSRPKKKKPRTKNTPASASLEGLAQTAGRRPSEGNEPSTKELKEHPEAPVQRRQKKTRLPLELETSSTQKKSSSSSLLRNENGIDAEPAEEAVIQKPRRKTKKTQPAELQYANELGVEDEDIITDEQTTVEQQSVFTAPTGISQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKPSWTTRDVALTVHRAFRMIGLFSHGFLAGCAVWNIVVIYVLAGDQLSNLSNLLQQYKTLAYPFQSLLYLLLALSTISAFDRIDFAKISVAIRNFLALDPTALASFLYFTALILSLSQQMTSDRIHLYTPSSVNGSLWEAGIEEQILQPWIVVNLVVALLVGLSWLFLSYRPGMDLSEELMFSSEVEEYPDKEKEIKASS

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=Q96Q45-1; Sequence=Displayed; Name=2; IsoId=Q96Q45-2; Sequence=VSP_016628; Name=3; IsoId=Q96Q45-3; Sequence=VSP_042381; Name=4; IsoId=Q96Q45-4; Sequence=VSP_042382; Name=5; IsoId=Q96Q45-5; Sequence=VSP_042383

Alternative Sequence

1..14; MRTDSGARLEEGHL -> MGKNPV (in isoform 2); 1..14; MRTDSGARLEEGHL -> MTHCACARDRAREGWGARCLGARRPPRPAKRRMGKNPV (in isoform 3); 36..130; Missing (in isoform 4); 132; K -> KRPYYR (in isoform 5)

3D Structural Models

Domain & Motif Annotations

Compositional Bias

1..14; Basic and acidic residues; 60..77; Basic and acidic residues; 95..106; Low complexity

Region

1..137; Disordered

Protein Families

TMEM237 family

Sequence Similarities

Belongs to the TMEM237 family.

Clinical Relevance

Disease Involvement

CiliopathyJoubert syndrome

Antibody

HPA052596 HPA054732