Protein detail
FCRL5
Fc receptor-like protein 5 (FcR-like protein 5) (FcRL5) (BXMAS1) (Fc receptor homolog 5) (FcRH5) (Immune receptor translocation-associated protein 2) (CD antigen CD307e)
Entry name FCRL5 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 3 | Transmembrane count 1 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Fc receptor-like protein 5 (FcR-like protein 5) (FcRL5) (BXMAS1) (Fc receptor homolog 5) (FcRH5) (Immune receptor translocation-associated protein 2) (CD antigen CD307e)
Protein Function (3)
- Disease related genes
- Predicted secreted proteins
- CD markers
Transmembrane
852..872; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
3
EVMP confidence score
0.25
Function & Pathway5
Protein Function (3)
- Disease related genes
- Predicted secreted proteins
- CD markers
Cellular Component (4)
Molecular Function (3)
Biological Process (3)
Mediation Categories (2)
Fusion and delivery mediationImmune mediation
Relations & Evidence22
Ligand-Receptor Signaling (21)
21 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | GO_Intercell | No | Yes | Yes | Yes | No |
| receptor | receptor | OmniPath | No | Yes | Yes | Yes | No |
| extracellular | extracellular | DGIdb | No | No | Yes | Yes | No |
| extracellular | extracellular | OmniPath | No | No | Yes | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | Yes | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | Yes | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | Yes | Yes | No |
| transmembrane | transmembrane | GO_Intercell | No | No | Yes | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | Yes | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | Yes | Yes | No |
Page 1 of 3Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 37047096 |
Sequence, Structure & Domains10
Sequences
Length
977
Mass
106,437
Sequence
MLLWVILLVLAPVSGQFARTPRPIIFLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHRYLGKEILRETPDNILEVQESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSVVLRCRAKAEVTLNNTIYKNDNVLAFLNKRTDFHIPHACLKDNGAYRCTGYKESCCPVSSNTVKIQVQEPFTRPVLRASSFQPISGNPVTLTCETQLSLERSDVPLRFRFFRDDQTLGLGWSLSPNFQITAMWSKDSGFYWCKAATMPYSVISDSPRSWIQVQIPASHPVLTLSPEKALNFEGTKVTLHCETQEDSLRTLYRFYHEGVPLRHKSVRCERGASISFSLTTENSGNYYCTADNGLGAKPSKAVSLSVTVPVSHPVLNLSSPEDLIFEGAKVTLHCEAQRGSLPILYQFHHEGAALERRSANSAGGVAISFSLTAEHSGNYYCTADNGFGPQRSKAVSLSVTVPVSHPVLTLSSAEALTFEGATVTLHCEVQRGSPQILYQFYHEDMPLWSSSTPSVGRVSFSFSLTEGHSGNYYCTADNGFGPQRSEVVSLFVTVPVSRPILTLRVPRAQAVVGDLLELHCEAPRGSPPILYWFYHEDVTLGSSSAPSGGEASFNLSLTAEHSGNYSCEANNGLVAQHSDTISLSVIVPVSRPILTFRAPRAQAVVGDLLELHCEALRGSSPILYWFYHEDVTLGKISAPSGGGASFNLSLTTEHSGIYSCEADNGLEAQRSEMVTLKVAVPVSRPVLTLRAPGTHAAVGDLLELHCEALRGSPLILYRFFHEDVTLGNRSSPSGGASLNLSLTAEHSGNYSCEADNGLGAQRSETVTLYITGLTANRSGPFATGVAGGLLSIAGLAAGALLLYCWLSRKAGRKPASDPARSPSDSDSQEPTYHNVPAWEELQPVYTNANPRGENVVYSEVRIIQEKKKHAVASDPRHLRNKGSPIIYSEVKVASTPVSGSLFLASSAPHR
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=IRTA2c; IsoId=Q96RD9-1; Sequence=Displayed; Name=2; IsoId=Q96RD9-2; Sequence=VSP_017379, VSP_017380; Name=3; Synonyms=IRTA2a; IsoId=Q96RD9-3; Sequence=VSP_017385, VSP_017386; Name=4; Synonyms=IRTA2b; IsoId=Q96RD9-4; Sequence=VSP_017383, VSP_017384; Name=5; Synonyms=IRTA2d; IsoId=Q96RD9-5; Sequence=VSP_017381, VSP_017382
Alternative Sequence
103..124; ASLILQAPLSVFEGDSVVLRCR -> EMGFPHAAQANVELLGSSDLLT (in isoform 2); 125..977; Missing (in isoform 2); 152; H -> Q (in isoform 5); 153..977; Missing (in isoform 5); 561..592; VPVSRPILTLRVPRAQAVVGDLLELHCEAPRG -> GKCWVLASHPPLAEFSLTHSFKNLFALSSFLP (in isoform 4); 593..977; Missing (in isoform 4); 747..759; VPVSRPVLTLRAP -> GEWALPTSSTSEN (in isoform 3); 760..977; Missing (in isoform 3)
Domain & Motif Annotations
Compositional Bias
883..892; Low complexity
Motif
897..902; ITIM motif 1; 910..915; ITIM motif 2; 922..927; ITIM motif 3; 952..957; ITIM motif 4
Domain (CC)
Contains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM).
Domain (FT)
23..101; Ig-like C2-type 1; 188..271; Ig-like C2-type 2; 287..374; Ig-like C2-type 3; 380..463; Ig-like C2-type 4; 473..556; Ig-like C2-type 5; 566..651; Ig-like C2-type 6; 659..744; Ig-like C2-type 7; 752..834; Ig-like C2-type 8
Region
879..898; Disordered
Supporting Publications3
| PMID | Title | Abstract |
|---|---|---|
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No abstract available |
| 39207047 | The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis. | No abstract available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No abstract available |