Protein detail

FCRL5

Fc receptor-like protein 5 (FcR-like protein 5) (FcRL5) (BXMAS1) (Fc receptor homolog 5) (FcRH5) (Immune receptor translocation-associated protein 2) (CD antigen CD307e)

Entry name FCRL5	UniProt ID Q96RD9	EVMP confidence score 0.25
Supporting publications (n) 3	Transmembrane count 1	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information8

Protein Names

Fc receptor-like protein 5 (FcR-like protein 5) (FcRL5) (BXMAS1) (Fc receptor homolog 5) (FcRH5) (Immune receptor translocation-associated protein 2) (CD antigen CD307e)

Protein Function (3)

Disease related genes
Predicted secreted proteins
CD markers

Transmembrane

852..872; Helical

Transmembrane Count

Ensembl

ENSG00000143297

Entrez Gene Symbol

FCRL5

Supporting publications (n)

EVMP confidence score

0.25

Function & Pathway5

Protein Function (3)

Disease related genes
Predicted secreted proteins
CD markers

Cellular Component (4)

Molecular Function (3)

Biological Process (3)

Mediation Categories (2)

Fusion and delivery mediationImmune mediation

Relations & Evidence22

Ligand-Receptor Signaling (21)

21 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane_predicted	Phobius	No	No	Yes	Yes	No

Page 3 of 3Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	1	37047096

Sequence, Structure & Domains10

Sequences

Length

977

Mass

106,437

Sequence

MLLWVILLVLAPVSGQFARTPRPIIFLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHRYLGKEILRETPDNILEVQESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSVVLRCRAKAEVTLNNTIYKNDNVLAFLNKRTDFHIPHACLKDNGAYRCTGYKESCCPVSSNTVKIQVQEPFTRPVLRASSFQPISGNPVTLTCETQLSLERSDVPLRFRFFRDDQTLGLGWSLSPNFQITAMWSKDSGFYWCKAATMPYSVISDSPRSWIQVQIPASHPVLTLSPEKALNFEGTKVTLHCETQEDSLRTLYRFYHEGVPLRHKSVRCERGASISFSLTTENSGNYYCTADNGLGAKPSKAVSLSVTVPVSHPVLNLSSPEDLIFEGAKVTLHCEAQRGSLPILYQFHHEGAALERRSANSAGGVAISFSLTAEHSGNYYCTADNGFGPQRSKAVSLSVTVPVSHPVLTLSSAEALTFEGATVTLHCEVQRGSPQILYQFYHEDMPLWSSSTPSVGRVSFSFSLTEGHSGNYYCTADNGFGPQRSEVVSLFVTVPVSRPILTLRVPRAQAVVGDLLELHCEAPRGSPPILYWFYHEDVTLGSSSAPSGGEASFNLSLTAEHSGNYSCEANNGLVAQHSDTISLSVIVPVSRPILTFRAPRAQAVVGDLLELHCEALRGSSPILYWFYHEDVTLGKISAPSGGGASFNLSLTTEHSGIYSCEADNGLEAQRSEMVTLKVAVPVSRPVLTLRAPGTHAAVGDLLELHCEALRGSPLILYRFFHEDVTLGNRSSPSGGASLNLSLTAEHSGNYSCEADNGLGAQRSETVTLYITGLTANRSGPFATGVAGGLLSIAGLAAGALLLYCWLSRKAGRKPASDPARSPSDSDSQEPTYHNVPAWEELQPVYTNANPRGENVVYSEVRIIQEKKKHAVASDPRHLRNKGSPIIYSEVKVASTPVSGSLFLASSAPHR

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=IRTA2c; IsoId=Q96RD9-1; Sequence=Displayed; Name=2; IsoId=Q96RD9-2; Sequence=VSP_017379, VSP_017380; Name=3; Synonyms=IRTA2a; IsoId=Q96RD9-3; Sequence=VSP_017385, VSP_017386; Name=4; Synonyms=IRTA2b; IsoId=Q96RD9-4; Sequence=VSP_017383, VSP_017384; Name=5; Synonyms=IRTA2d; IsoId=Q96RD9-5; Sequence=VSP_017381, VSP_017382

Alternative Sequence

103..124; ASLILQAPLSVFEGDSVVLRCR -> EMGFPHAAQANVELLGSSDLLT (in isoform 2); 125..977; Missing (in isoform 2); 152; H -> Q (in isoform 5); 153..977; Missing (in isoform 5); 561..592; VPVSRPILTLRVPRAQAVVGDLLELHCEAPRG -> GKCWVLASHPPLAEFSLTHSFKNLFALSSFLP (in isoform 4); 593..977; Missing (in isoform 4); 747..759; VPVSRPVLTLRAP -> GEWALPTSSTSEN (in isoform 3); 760..977; Missing (in isoform 3)

Domain & Motif Annotations

Compositional Bias

883..892; Low complexity

Motif

897..902; ITIM motif 1; 910..915; ITIM motif 2; 922..927; ITIM motif 3; 952..957; ITIM motif 4

Domain (CC)

Contains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM).

Domain (FT)

23..101; Ig-like C2-type 1; 188..271; Ig-like C2-type 2; 287..374; Ig-like C2-type 3; 380..463; Ig-like C2-type 4; 473..556; Ig-like C2-type 5; 566..651; Ig-like C2-type 6; 659..744; Ig-like C2-type 7; 752..834; Ig-like C2-type 8

Region

879..898; Disordered

Supporting Publications3

PMID	Title	Abstract
31805958	Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment.	No abstract available
39207047	The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis.	No abstract available
40189497	Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis.	No abstract available