Protein detail

GA2L1

GAS2-like protein 1 (GAS2-related protein on chromosome 22) (Growth arrest-specific protein 2-like 1)

Entry name GA2L1	UniProt ID Q99501	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Plasma proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

GAS2-like protein 1 (GAS2-related protein on chromosome 22) (Growth arrest-specific protein 2-like 1)

Protein Class (2)

Plasma proteinsPredicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000185340

Entrez Gene Symbol

GAS2L1

Gene Synonym

GAR22

Gene Description

Growth arrest specific 2 like 1

Chromosome

Position

29306618-29312787

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization3

Tissue Specificskin 1Cell SpecificColonocytesBlood Lineage Specificgranulocytes

Function & Pathway5

Protein Function

Predicted intracellular proteins

Cellular Component (5)

Molecular Function (4)

Biological Process (3)

Mediation Categories

Fusion and delivery mediation

Relations & Evidence10

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
GAS2L1	NEK2	P51955	S	352	phosphorylation	PhosphoSite

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
NEK2	P51955	GA2L1	Q99501	Yes	Yes	No	SIGNORPhosphoSitePhosphoSite_ProtMapperProtMapper	PhosphoSite:32289147 SIGNOR:32289147

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	CCND1 CDKN2C FAM114A1 GAS2L1 MAPRE3 WDR45B	P24385 P42773 Q5MNZ6 Q8IWE2 Q99501 Q9UPY8	0:0:0:0:0:0	hu.MAP2
	DST FAM114A1 GAS2L1 KIF18B MAPRE1 MAPRE3 WDR45B	Q03001 Q15691 Q5MNZ6 Q86Y91 Q8IWE2 Q99501 Q9UPY8	0:0:0:0:0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationDensity Gradient CentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography	R SequencingMass spectrometry	10	27863537 31196968 33204424 36398564 37786918 34817906 28986585 27894104 29148239 32089743

Sequence, Structure & Domains10

Sequences

Length

681

Mass

72,717

Sequence

MADPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLAEWLNALYGLGLPGGGDGFLTGLATGTTLCQHANAVTEAARALAAARPARGVAFQAHSVVPGSFMARDNVATFIGWCRVELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIERELRAAPPAPNAPAAGEDTTETAPAPGTPARGPRMTPSDLRNLDELVREILGRCTCPDQFPMIKVSEGKYRVGDSSLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSTAHRPPQPRVCTFSPQRVSPTTSPRPASPVPGSERRGSRPEMTPVSLRSTKEGPETPPRPRDQLPPHPRSRRYSGDSDSSASSAQSGPLGTRSDDTGTGPRRERPSRRLTTGTPASPRRPPALRSQSRDRLDRGRPRGAPGGRGAQLSVPSPARRARSQSREEQAVLLVRRDRDGQHSWVPRGRGSGGSGRSTPQTPRARSPAAPRLSRVSSPSPELGTTPASIFRTPLQLDPQQEQQLFRRLEEEFLANARALEAVASVTPTGPVPDPARAPDPPAPDSAYCSSSSSSSSLSVLGGKCGQPGDSGRTANGLPGPRSQALSSSSDEGSPCPGMGGPLDAPGSPLACTEPSRTWARGRMDTQPDRKPSRIPTPRGPRRPSGPAELGTWHALHSVTPRAEPDSWM

Alternative Products

Event=Alternative splicing; Named isoforms=4; Name=1; Synonyms=Beta; IsoId=Q99501-1; Sequence=Displayed; Name=2; Synonyms=Alpha; IsoId=Q99501-2; Sequence=VSP_015493; Name=3; IsoId=Q99501-3; Sequence=VSP_015494, VSP_015495; Name=4; IsoId=Q99501-4; Sequence=VSP_055754

Alternative Sequence

280..329; AHRPPQPRVCTFSPQRVSPTTSPRPASPVPGSERRGSRPEMTPVSLRSTK -> GPGISCPPIPAPAATPGTVTPQPPPPRAAPLVPAVMTQALAPGGSDPAGG (in isoform 3); 330..681; Missing (in isoform 3); 337..563; Missing (in isoform 4); 338..681; Missing (in isoform 2)

Domain & Motif Annotations

Compositional Bias

186..199; Low complexity; 291..303; Polar residues; 327..342; Basic and acidic residues; 354..365; Low complexity; 370..381; Basic and acidic residues; 404..413; Basic and acidic residues; 437..454; Basic and acidic residues; 475..493; Low complexity; 542..556; Pro residues; 557..571; Low complexity; 634..644; Basic and acidic residues

Domain (FT)

27..148; Calponin-homology (CH); 203..275; GAR

Region

168..204; Disordered; 278..509; Disordered; 536..681; Disordered

Protein Families

GAS2 family

Sequence Similarities

Belongs to the GAS2 family.

Clinical Relevance4

Antibody

HPA019858

Interaction Protein

ENSG00000101367

Interaction Count

Interaction Dataset

biogrid_bioplex

Supporting Publications1

PMID	Title	Abstract
32916986	Proteomic Approach for Searching for Universal, Tissue-Specific, and Line-Specific Markers of Extracellular Vesicles in Lung and Colorectal Adenocarcinoma Cell Lines.	No abstract available