Protein detail
NEUR1
Sialidase-1 (EC 3.2.1.18) (Acetylneuraminyl hydrolase) (G9 sialidase) (Lysosomal sialidase) (N-acetyl-alpha-neuraminidase 1)
Protein symbol NEUR1 | UniProt ID | EVMP score 0.25 |
Frequency 1 | Transmembrane count | Protein classification Disease related genesEnzymesFDA approved drug targetsHuman disease related genesMetabolic proteinsPredicted intracellular proteins |
Basic Information
Protein Names
Sialidase-1 (EC 3.2.1.18) (Acetylneuraminyl hydrolase) (G9 sialidase) (Lysosomal sialidase) (N-acetyl-alpha-neuraminidase 1)
Protein Class
Disease related genesEnzymesFDA approved drug targetsHuman disease related genesMetabolic proteinsPredicted intracellular proteins
Protein Function
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of glycan/glycoprotein metabolism
- Predicted intracellular proteins
- Enzymes
- ENZYME proteins:Hydrolases
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- Human disease related genes:Congenital disorders of metabolism:Lysosomal storage diseases
Ensembl
Entrez Gene Symbol
Gene Synonym
NEU
Gene Description
Neuraminidase 1
Chromosome
6
Position
31857659-31862905
Frequency
1
EVMP Score
0.25
Fluorescence & Localization
Function & Pathway
Protein Function
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of glycan/glycoprotein metabolism
- Predicted intracellular proteins
- Enzymes
- ENZYME proteins:Hydrolases
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- Human disease related genes:Congenital disorders of metabolism:Lysosomal storage diseases
Cellular Component
- GO:0005576 extracellular region
- GO:0005737 cytoplasm
- GO:0005764 lysosome
- GO:0005765 lysosomal membrane
- GO:0005886 plasma membrane
- GO:0016020 membrane
- GO:0030054 cell junction
- GO:0035580 specific granule lumen
- GO:0043202 lysosomal lumen
- GO:0043231 intracellular membrane-bounded organelle
- GO:0070062 extracellular exosome
Molecular Function
KEGG
Reactome
- R-hsa-446203 asparagine n linked glycosylation
- R-hsa-446193 biosynthesis of the n glycan precursor dolichol lipid linked oligosaccharide llo and transfer to a nascent protein
- R-hsa-3781860 diseases associated with n glycosylation of proteins
- R-hsa-3781865 diseases of glycosylation
- R-hsa-5668914 diseases of metabolism
- R-hsa-9840310 glycosphingolipid catabolism
- R-hsa-1660662 glycosphingolipid metabolism
- R-hsa-168249 innate immune system
- R-hsa-556833 metabolism of lipids
- R-hsa-6798695 neutrophil degranulation
- R-hsa-597592 post translational protein modification
- R-hsa-4085001 sialic acid metabolism
- R-hsa-428157 sphingolipid metabolism
- R-hsa-446219 synthesis of substrates in n glycan biosythesis
Canonical Pathways
- M5880 Naba ecm affiliated
- M5885 Naba matrisome associated
- M5889 Naba matrisome
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence
Enzyme-Mediated Modification
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| NEU1 | INSR | P06213 | Y | 242 | phosphorylation | KEA | KEA:17570479 |
| NEU1 | PRKACB | P22694 | S | 244 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling
20 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_sosui | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
Page 2 of 2Previous
Regulatory Interaction Network
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| NEUR1 | Q99519 | COMPLEX:P05556_P08648 | Yes | No | Yes | SIGNOR | SIGNOR:32164705 |
Protein Complex Composition
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| GALNS-lysosomal hydrolase 1.27 MDa complex | CTSAGALNSGLB1NEU1 | P10619P16278P34059Q99519 | 1:1:1:1 | CompleatCORUM | CORUM:1379Compleat:HC2734 | 8910459 |
| CTSAGLB1NEU1UBC | P0CG48P10619P16278Q99519 | 1:1:1:1 | CompleatCFinder | Compleat:HC8364 | ||
| DLGAP5NEU1RANBP3RCC1 | P18754Q15398Q99519Q9H6Z4 | 0:0:0:0 | hu.MAP |
Sequence, Structure & Domains
Sequences
Length
415
Mass
45,467
Sequence
MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
3D Structural Models
Domain & Motif Annotations
Repeat
112..123; BNR 1; 172..183; BNR 2; 231..242; BNR 3; 347..358; BNR 4
Motif
77..80; FRIP motif; 412..415; Internalization signal
Domain (CC)
A C-terminal internalization signal (YGTL) appears to allow the targeting of plasma membrane proteins to endosomes.
Protein Families
Glycosyl hydrolase 33 family
Sequence Similarities
Belongs to the glycosyl hydrolase 33 family.