Protein detail

NEUR1

Sialidase-1 (EC 3.2.1.18) (Acetylneuraminyl hydrolase) (G9 sialidase) (Lysosomal sialidase) (N-acetyl-alpha-neuraminidase 1)

Entry name NEUR1	UniProt ID Q99519	EVMP confidence score 0.25
Supporting publications (n) 1	Transmembrane count	Protein classification Disease related genesEnzymesFDA approved drug targetsHuman disease related genesMetabolic proteinsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Sialidase-1 (EC 3.2.1.18) (Acetylneuraminyl hydrolase) (G9 sialidase) (Lysosomal sialidase) (N-acetyl-alpha-neuraminidase 1)

Protein Class (6)

Disease related genesEnzymesFDA approved drug targetsHuman disease related genesMetabolic proteinsPredicted intracellular proteins

Protein Function (7)

Human disease related genes:Congenital disorders of metabolism:Congenital disorders of glycan/glycoprotein metabolism
Predicted intracellular proteins
Enzymes
ENZYME proteins:Hydrolases
Disease related genes
FDA approved drug targets:Small molecule drugs
Human disease related genes:Congenital disorders of metabolism:Lysosomal storage diseases

Ensembl

ENSG00000204386

Entrez Gene Symbol

NEU1

Gene Synonym

NEU

Gene Description

Neuraminidase 1

Chromosome

Position

31857659-31862905

Supporting publications (n)

EVMP confidence score

0.25

Function & Pathway7

Protein Function (7)

Human disease related genes:Congenital disorders of metabolism:Congenital disorders of glycan/glycoprotein metabolism
Predicted intracellular proteins
Enzymes
ENZYME proteins:Hydrolases
Disease related genes
FDA approved drug targets:Small molecule drugs
Human disease related genes:Congenital disorders of metabolism:Lysosomal storage diseases

Cellular Component (11)

Page 1 of 2

Molecular Function (3)

KEGG (4)

Reactome (14)

Page 1 of 2

Canonical Pathways (3)

M5880 Naba ecm affiliated
M5885 Naba matrisome associated
M5889 Naba matrisome

Mediation Categories (4)

Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediation

Relations & Evidence27

Enzyme-Mediated Modification (2)

2 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
NEU1	INSR	P06213	Y	242	phosphorylation	KEA	KEA:17570479
NEU1	PRKACB	P22694	S	244	phosphorylation	KEA	KEA:17570479

Ligand-Receptor Signaling (20)

20 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane	Ramilowski_location	No	No	No	Yes	No
transmembrane	transmembrane	OmniPath	No	No	No	Yes	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	Yes	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	CSPA	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane_predicted	Phobius	No	No	No	Yes	No
transmembrane_phobius	transmembrane_predicted	Almen2009	No	No	No	Yes	No
transmembrane_sosui	transmembrane_predicted	Almen2009	No	No	No	Yes	No
transmembrane_tmhmm	transmembrane_predicted	Almen2009	No	No	No	Yes	No

Page 2 of 2Previous

Regulatory Interaction Network (1)

1 record.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
NEUR1	Q99519		COMPLEX:P05556_P08648	Yes	No	Yes	SIGNOR	SIGNOR:32164705

Protein Complex Composition (3)

3 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
GALNS-lysosomal hydrolase 1.27 MDa complex	CTSA GALNS GLB1 NEU1	P10619 P16278 P34059 Q99519	1:1:1:1	CompleatCORUM	CORUM:1379Compleat:HC2734	8910459
	CTSA GLB1 NEU1 UBC	P0CG48 P10619 P16278 Q99519	1:1:1:1	CompleatCFinder	Compleat:HC8364
	DLGAP5 NEU1 RANBP3 RCC1	P18754 Q15398 Q99519 Q9H6Z4	0:0:0:0	hu.MAP

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryWestern blottingELISA	3	30382917 38731868 26775013

Sequence, Structure & Domains8

Sequences

Length

415

Mass

45,467

Sequence

MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL

Domain & Motif Annotations

Repeat

112..123; BNR 1; 172..183; BNR 2; 231..242; BNR 3; 347..358; BNR 4

Motif

77..80; FRIP motif; 412..415; Internalization signal

Domain (CC)

A C-terminal internalization signal (YGTL) appears to allow the targeting of plasma membrane proteins to endosomes.

Protein Families

Glycosyl hydrolase 33 family

Sequence Similarities

Belongs to the glycosyl hydrolase 33 family.

Clinical Relevance3

Disease Involvement (2)

Disease variantFDA approved drug targets

Drug Targets

FDA approved drug targets

Antibody (2)

HPA015634 HPA021506

Supporting Publications1

PMID	Title	Abstract
32384937	Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles.	No abstract available