Protein detail

SORT

Sortilin (100 kDa NT receptor) (Glycoprotein 95) (Gp95) (Neurotensin receptor 3) (NT3) (NTR3)

Entry name SORT	UniProt ID Q99523	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count 1	Protein classification Disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Sortilin (100 kDa NT receptor) (Glycoprotein 95) (Gp95) (Neurotensin receptor 3) (NT3) (NTR3)

Protein Class (5)

Disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters

Protein Function (4)

Disease related genes
Transporters
Predicted intracellular proteins
Potential drug targets

Transmembrane

756..778; Helical

Transmembrane Count

Ensembl

ENSG00000134243

Entrez Gene Symbol

SORT1

Gene Synonym (2)

Gp95NT3

Gene Description

Sortilin 1

Chromosome

Position

109309568-109397918

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization5

Tissue SpecificliverCell SpecificHepatocytesSingle-Nuclei Brain Specifichippocampal CA1-3Blood Cell Specificclassical monocyteBlood Lineage Specificdendritic cells

Function & Pathway7

Protein Function (4)

Disease related genes
Transporters
Predicted intracellular proteins
Potential drug targets

Cellular Component (18)

Page 1 of 2

Molecular Function (6)

Biological Process (3)

KEGG (3)

Reactome (4)

Mediation Categories (3)

Clinical-translation mediationFusion and delivery mediationReceptor-signaling mediation

Relations & Evidence65

Enzyme-Mediated Modification (2)

2 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
SORT1	CSNK2B	P67870	S	825	phosphorylation	PhosphoSitePhosphoSite_ProtMapperProtMapper
SORT1	PAK2	Q13177	S	793	phosphorylation	PhosphoSite

Ligand-Receptor Signaling (33)

33 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
extracellular	extracellular	HPMR	No	No	No	Yes	No
extracellular	extracellular	OmniPath	No	No	No	Yes	No
intracellular	intracellular	LOCATE	No	No	No	Yes	No
intracellular	intracellular	ComPPI	No	No	No	Yes	No
intracellular	intracellular	GO_Intercell	No	No	No	Yes	No
intracellular	intracellular	UniProt_location	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	No	Yes	No
adhesion	adhesion	OmniPath	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	No	Yes	No

Page 1 of 4Next

Regulatory Interaction Network (7)

7 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PAK1	Q13153	SORT	Q99523	Yes	No	Yes	SIGNOR	SIGNOR:31767632
	COMPLEX:O43747_P61966_Q10567_Q9BXS5	SORT	Q99523	Yes	Yes	No	SIGNOR	SIGNOR:31767632
PAK3	O75914	SORT	Q99523	Yes	No	Yes	SIGNOR	SIGNOR:31767632
PAK2	Q13177	SORT	Q99523	Yes	No	Yes	SIGNORPhosphoSitePhosphoSite_ProtMapperProtMapper	SIGNOR:31767632 PhosphoSite:25805502 PhosphoSite:31767632
SORT	Q99523	APOA1	P02647	Yes	Yes	No	SIGNOR	SIGNOR:23283348
SORT	Q99523	APOE	P02649	Yes	Yes	No	SIGNOR	SIGNOR:23283348
CSK2B	P67870	SORT	Q99523	Yes	Yes	No	iPTMnetPhosphoSite_norefSIGNORProtMapperPhosphoSite_ProtMapper	SIGNOR:25805502

Protein Complex Composition (22)

22 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
AP1B1 AP1G1 AP1M1 AP1M2 AP1S1 AP1S2 AP2B1 CLINT1 CLTB CLTC GAK GGA2 SORT1 UBC	O14976 O43747 P09497 P0CG48 P56377 P61966 P63010 Q00610 Q10567 Q14677 Q99523 Q9BXS5 Q9UJY4 Q9Y6Q5	1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8601
AP1B1 AP1G1 AP1S2 ARF1 ARF3 ATP9A CLINT1 CLTB CLTC GGA1 GGA2 GGA3 MON2 SORT1 UBC	O43747 O75110 P09497 P0CG48 P56377 P61204 P84077 Q00610 Q10567 Q14677 Q7Z3U7 Q99523 Q9NZ52 Q9UJY4 Q9UJY5	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9778
AP1B1 AP1G1 AP1M1 AP1M2 AP1S1 AP1S2 AP2B1 CLINT1 CLTA CLTC GGA2 PCSK5 SORT1 UBC	O43747 P09496 P0CG48 P56377 P61966 P63010 Q00610 Q10567 Q14677 Q92824 Q99523 Q9BXS5 Q9UJY4 Q9Y6Q5	1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4982
AP1B1 AP1G1 AP1M1 AP1M2 AP1S1 AP2B1 ARL1 CLINT1 CLTB CLTC GGA2 SORT1 UBC VPS53	O43747 P09497 P0CG48 P40616 P61966 P63010 Q00610 Q10567 Q14677 Q5VIR6 Q99523 Q9BXS5 Q9UJY4 Q9Y6Q5	1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7917
AP1B1 AP1G1 AP1M2 AP1S1 AP1S2 ARF1 ARF3 CLINT1 CLTB CLTC GGA1 GGA2 GGA3 SORT1 UBC	O43747 P09497 P0CG48 P56377 P61204 P61966 P84077 Q00610 Q10567 Q14677 Q99523 Q9NZ52 Q9UJY4 Q9UJY5 Q9Y6Q5	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7705
AP1B1 AP1G1 AP1S2 ARF1 ARF3 ARL5B CLINT1 CLTC GGA1 GGA2 GGA3 MON2 SORT1 UBC VPS53	O43747 P0CG48 P56377 P61204 P84077 Q00610 Q10567 Q14677 Q5VIR6 Q7Z3U7 Q96KC2 Q99523 Q9NZ52 Q9UJY4 Q9UJY5	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9194
SLC66A2 SNX1 SNX2 SNX6 SORT1 UBC VPS26A VPS29 VPS35	O60749 O75436 P0CG48 Q13596 Q8N2U9 Q96QK1 Q99523 Q9UBQ0 Q9UNH7	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4802
CPOX EDEM3 P4HB SNX1 SORT1 UBC VPS26A VPS29 VPS35	O75436 P07237 P0CG48 P36551 Q13596 Q96QK1 Q99523 Q9BZQ6 Q9UBQ0	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9395
CPOX EDEM3 SNX1 SORT1 UBC VPS26A VPS26B VPS29 VPS35	O75436 P0CG48 P36551 Q13596 Q4G0F5 Q96QK1 Q99523 Q9BZQ6 Q9UBQ0	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5913
PKN3 SNX1 SORT1 TRMT5 UBC VPS26A VPS26B VPS29 VPS35	O75436 P0CG48 Q13596 Q32P41 Q4G0F5 Q6P5Z2 Q96QK1 Q99523 Q9UBQ0	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4050

Page 1 of 3Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryMass spectrometry [LTQ-FT Ultra]	1	37714423

Sequence, Structure & Domains16

Sequences

Length

831

Mass

92,068

Sequence

MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q99523-1; Sequence=Displayed; Name=2; IsoId=Q99523-2; Sequence=VSP_046239, VSP_046240

Alternative Sequence

1..136; Missing (in isoform 2); 278..279; KA -> T (in isoform 2)

3D Structural Models

Turn

177..179; 277..282; 333..335; 397..399; 449..451; 576..578; 630..633

Helix

92..97; 135..137; 158..161; 168..170; 263..265; 465..469; 529..531; 591..593; 604..606; 614..616; 670..672; 696..704; 707..710; 737..740; 741..743

Beta Strand

100..106; 110..116; 118..121; 124..130; 141..149; 152..154; 163..167; 172..174; 182..186; 187..190; 196..202; 208..211; 216..218; 221..223; 226..234; 239..244; 247..261; 267..271; 273..275; 283..291; 297..309; 312..318; 320..323; 325..332; 351..356; 361..366; 368..370; 372..379; 381..383; 385..395; 405..410; 414..419; 421..423; 425..432; 438..441; 446..448; 453..456; 459..462; 482..484; 488..497; 504..510; 516..521; 523..528; 533..538; 540..542; 546..552; 558..561; 567..573; 581..590; 595..603; 617..621; 638..645; 661..665; 673..675; 683..685; 714..717; 724..726; 734..736

3D Structure

X-ray crystallography (14)

Domain & Motif Annotations

Repeat

145..156; BNR 1; 198..209; BNR 2; 240..251; BNR 3; 287..298; BNR 4; 328..339; BNR 5; 377..388; BNR 6; 428..439; BNR 7; 506..517; BNR 8; 548..559; BNR 9

Motif

787..792; Endocytosis signal; 826..830; DXXLL motif involved in the interaction with GGA1

Domain (CC)

The N-terminal propeptide may facilitate precursor transport within the Golgi stack. Intrachain binding of the N-terminal propeptide and the extracellular domain may also inhibit premature ligand binding.; DOMAIN: The extracellular domain may be shed following protease cleavage in some cell types.

Domain (FT)

98..742; Vps10p

Region

50..61; Intrachain binding of the propeptide and the extracellular domain; 98..604; 10-bladed beta-propeller; 612..756; Interactions with LRPAP1 and NGFB; 612..666; 10CCa cysteine-knot; 668..742; 10CCb cysteine-knot; 779..831; Golgi to endosome transport and interactions with GGA1 and GGA2

Protein Families (2)