Protein detail
SORT
Sortilin (100 kDa NT receptor) (Glycoprotein 95) (Gp95) (Neurotensin receptor 3) (NT3) (NTR3)
Entry name SORT | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Sortilin (100 kDa NT receptor) (Glycoprotein 95) (Gp95) (Neurotensin receptor 3) (NT3) (NTR3)
Protein Class (5)
Disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (4)
- Disease related genes
- Transporters
- Predicted intracellular proteins
- Potential drug targets
Transmembrane
756..778; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
Gp95NT3
Gene Description
Sortilin 1
Chromosome
1
Position
109309568-109397918
Supporting publications (n)
1
EVMP confidence score
0.28
Fluorescence & Localization
Tissue SpecificliverCell SpecificHepatocytesSingle-Nuclei Brain Specifichippocampal CA1-3Blood Cell Specificclassical monocyteBlood Lineage Specificdendritic cells
Function & Pathway
Protein Function (4)
- Disease related genes
- Transporters
- Predicted intracellular proteins
- Potential drug targets
Cellular Component (18)
- GO:0005764 lysosome
- GO:0005765 lysosomal membrane
- GO:0005769 early endosome
- GO:0005789 endoplasmic reticulum membrane
- GO:0005794 Golgi apparatus
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0005905 clathrin-coated pit
- GO:0009986 cell surface
- GO:0010008 endosome membrane
Page 1 of 2
Molecular Function (6)
Biological Process (3)
KEGG (3)
Reactome (4)
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationReceptor-signaling mediation
Relations & Evidence65
Enzyme-Mediated Modification (2)
Ligand-Receptor Signaling (33)
33 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | HPMR | Yes | ||||
| extracellular | extracellular | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | UniProt_location | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | ||
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes |
Page 1 of 4Next
Regulatory Interaction Network (7)
7 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| PAK1 | Q13153 | SORT | Q99523 | Yes | Yes | SIGNOR | SIGNOR:31767632 | |
| COMPLEX:O43747_P61966_Q10567_Q9BXS5 | SORT | Q99523 | Yes | Yes | SIGNOR | SIGNOR:31767632 | ||
| PAK3 | O75914 | SORT | Q99523 | Yes | Yes | SIGNOR | SIGNOR:31767632 | |
| PAK2 | Q13177 | SORT | Q99523 | Yes | Yes | SIGNORPhosphoSitePhosphoSite_ProtMapperProtMapper | SIGNOR:31767632PhosphoSite:25805502PhosphoSite:31767632 | |
| SORT | Q99523 | APOA1 | P02647 | Yes | Yes | SIGNOR | SIGNOR:23283348 | |
| SORT | Q99523 | APOE | P02649 | Yes | Yes | SIGNOR | SIGNOR:23283348 | |
| CSK2B | P67870 | SORT | Q99523 | Yes | Yes | iPTMnetPhosphoSite_norefSIGNORProtMapperPhosphoSite_ProtMapper | SIGNOR:25805502 |
Protein Complex Composition (22)
22 records.
Page 1 of 3Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryMass spectrometry [LTQ-FT Ultra] | 1 | 37714423 |
Sequence, Structure & Domains
Sequences
Length
831
Mass
92,068
Sequence
MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q99523-1; Sequence=Displayed; Name=2; IsoId=Q99523-2; Sequence=VSP_046239, VSP_046240
Alternative Sequence
1..136; Missing (in isoform 2); 278..279; KA -> T (in isoform 2)
3D Structural Models
Turn
177..179; 277..282; 333..335; 397..399; 449..451; 576..578; 630..633
Helix
92..97; 135..137; 158..161; 168..170; 263..265; 465..469; 529..531; 591..593; 604..606; 614..616; 670..672; 696..704; 707..710; 737..740; 741..743
Beta Strand
100..106; 110..116; 118..121; 124..130; 141..149; 152..154; 163..167; 172..174; 182..186; 187..190; 196..202; 208..211; 216..218; 221..223; 226..234; 239..244; 247..261; 267..271; 273..275; 283..291; 297..309; 312..318; 320..323; 325..332; 351..356; 361..366; 368..370; 372..379; 381..383; 385..395; 405..410; 414..419; 421..423; 425..432; 438..441; 446..448; 453..456; 459..462; 482..484; 488..497; 504..510; 516..521; 523..528; 533..538; 540..542; 546..552; 558..561; 567..573; 581..590; 595..603; 617..621; 638..645; 661..665; 673..675; 683..685; 714..717; 724..726; 734..736
3D Structure
X-ray crystallography (14)
Domain & Motif Annotations
Repeat
145..156; BNR 1; 198..209; BNR 2; 240..251; BNR 3; 287..298; BNR 4; 328..339; BNR 5; 377..388; BNR 6; 428..439; BNR 7; 506..517; BNR 8; 548..559; BNR 9
Motif
787..792; Endocytosis signal; 826..830; DXXLL motif involved in the interaction with GGA1
Domain (CC)
The N-terminal propeptide may facilitate precursor transport within the Golgi stack. Intrachain binding of the N-terminal propeptide and the extracellular domain may also inhibit premature ligand binding.; DOMAIN: The extracellular domain may be shed following protease cleavage in some cell types.
Domain (FT)
98..742; Vps10p
Region
50..61; Intrachain binding of the propeptide and the extracellular domain; 98..604; 10-bladed beta-propeller; 612..756; Interactions with LRPAP1 and NGFB; 612..666; 10CCa cysteine-knot; 668..742; 10CCb cysteine-knot; 779..831; Golgi to endosome transport and interactions with GGA1 and GGA2
Protein Families (2)
- VPS10-related sortilin family
- SORT1 subfamily
Sequence Similarities
Belongs to the VPS10-related sortilin family. SORT1 subfamily.
Clinical Relevance
Related Diseases (3)
Biomarker
Phase 3; Phase 2; Phase 1
Drugs
Interaction Protein (7)
ENSG00000100083ENSG00000103365ENSG00000123374ENSG00000134259ENSG00000140538ENSG00000163956ENSG00000198400
Interaction Count
7
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No related sentences available |