Protein detail

SORT

Sortilin (100 kDa NT receptor) (Glycoprotein 95) (Gp95) (Neurotensin receptor 3) (NT3) (NTR3)

Entry name SORT	UniProt ID Q99523	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count 1	Protein classification Disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Sortilin (100 kDa NT receptor) (Glycoprotein 95) (Gp95) (Neurotensin receptor 3) (NT3) (NTR3)

Protein Class (5)

Disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters

Protein Function (4)

Disease related genes
Transporters
Predicted intracellular proteins
Potential drug targets

Transmembrane

756..778; Helical

Transmembrane Count

Ensembl

ENSG00000134243

Entrez Gene Symbol

SORT1

Gene Synonym (2)

Gp95NT3

Gene Description

Sortilin 1

Chromosome

Position

109309568-109397918

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization5

Tissue SpecificliverCell SpecificHepatocytesSingle-Nuclei Brain Specifichippocampal CA1-3Blood Cell Specificclassical monocyteBlood Lineage Specificdendritic cells

Function & Pathway7

Protein Function (4)

Disease related genes
Transporters
Predicted intracellular proteins
Potential drug targets

Cellular Component (18)

Page 1 of 2

Molecular Function (6)

Biological Process (3)

KEGG (3)

Reactome (4)

Mediation Categories (3)

Clinical-translation mediationFusion and delivery mediationReceptor-signaling mediation

Relations & Evidence65

Enzyme-Mediated Modification (2)

2 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
SORT1	CSNK2B	P67870	S	825	phosphorylation	PhosphoSitePhosphoSite_ProtMapperProtMapper
SORT1	PAK2	Q13177	S	793	phosphorylation	PhosphoSite

Ligand-Receptor Signaling (33)

33 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No
transmembrane_predicted	transmembrane	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane	GO_Intercell	No	No	No	Yes	No
transmembrane	transmembrane	CellPhoneDB	No	No	No	Yes	No
transmembrane	transmembrane	TopDB	No	No	No	Yes	No
transmembrane	transmembrane	LOCATE	No	No	No	Yes	No
transmembrane	transmembrane	Ramilowski_location	No	No	No	Yes	No
transmembrane	transmembrane	OmniPath	No	No	No	Yes	No

Page 2 of 4Previous Next

Regulatory Interaction Network (7)

7 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PAK1	Q13153	SORT	Q99523	Yes	No	Yes	SIGNOR	SIGNOR:31767632
	COMPLEX:O43747_P61966_Q10567_Q9BXS5	SORT	Q99523	Yes	Yes	No	SIGNOR	SIGNOR:31767632
PAK3	O75914	SORT	Q99523	Yes	No	Yes	SIGNOR	SIGNOR:31767632
PAK2	Q13177	SORT	Q99523	Yes	No	Yes	SIGNORPhosphoSitePhosphoSite_ProtMapperProtMapper	SIGNOR:31767632 PhosphoSite:25805502 PhosphoSite:31767632
SORT	Q99523	APOA1	P02647	Yes	Yes	No	SIGNOR	SIGNOR:23283348
SORT	Q99523	APOE	P02649	Yes	Yes	No	SIGNOR	SIGNOR:23283348
CSK2B	P67870	SORT	Q99523	Yes	Yes	No	iPTMnetPhosphoSite_norefSIGNORProtMapperPhosphoSite_ProtMapper	SIGNOR:25805502

Protein Complex Composition (22)

22 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	SORT1 TMEM9	Q99523 Q9P0T7	0:0	hu.MAPhu.MAP2
	GGA1 SORT1	Q99523 Q9UJY5	2:2	PDB	PDB:3g2vPDB:3g2u

Page 3 of 3Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryMass spectrometry [LTQ-FT Ultra]	1	37714423

Sequence, Structure & Domains16

Sequences

Length

831

Mass

92,068

Sequence

MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q99523-1; Sequence=Displayed; Name=2; IsoId=Q99523-2; Sequence=VSP_046239, VSP_046240

Alternative Sequence

1..136; Missing (in isoform 2); 278..279; KA -> T (in isoform 2)

3D Structural Models

Turn

177..179; 277..282; 333..335; 397..399; 449..451; 576..578; 630..633

Helix

92..97; 135..137; 158..161; 168..170; 263..265; 465..469; 529..531; 591..593; 604..606; 614..616; 670..672; 696..704; 707..710; 737..740; 741..743

Beta Strand

100..106; 110..116; 118..121; 124..130; 141..149; 152..154; 163..167; 172..174; 182..186; 187..190; 196..202; 208..211; 216..218; 221..223; 226..234; 239..244; 247..261; 267..271; 273..275; 283..291; 297..309; 312..318; 320..323; 325..332; 351..356; 361..366; 368..370; 372..379; 381..383; 385..395; 405..410; 414..419; 421..423; 425..432; 438..441; 446..448; 453..456; 459..462; 482..484; 488..497; 504..510; 516..521; 523..528; 533..538; 540..542; 546..552; 558..561; 567..573; 581..590; 595..603; 617..621; 638..645; 661..665; 673..675; 683..685; 714..717; 724..726; 734..736

3D Structure

X-ray crystallography (14)

Domain & Motif Annotations

Repeat

145..156; BNR 1; 198..209; BNR 2; 240..251; BNR 3; 287..298; BNR 4; 328..339; BNR 5; 377..388; BNR 6; 428..439; BNR 7; 506..517; BNR 8; 548..559; BNR 9

Motif

787..792; Endocytosis signal; 826..830; DXXLL motif involved in the interaction with GGA1

Domain (CC)

The N-terminal propeptide may facilitate precursor transport within the Golgi stack. Intrachain binding of the N-terminal propeptide and the extracellular domain may also inhibit premature ligand binding.; DOMAIN: The extracellular domain may be shed following protease cleavage in some cell types.

Domain (FT)

98..742; Vps10p

Region

50..61; Intrachain binding of the propeptide and the extracellular domain; 98..604; 10-bladed beta-propeller; 612..756; Interactions with LRPAP1 and NGFB; 612..666; 10CCa cysteine-knot; 668..742; 10CCb cysteine-knot; 779..831; Golgi to endosome transport and interactions with GGA1 and GGA2

Protein Families (2)